KEGG   Cellulomonas fimi: Celf_3566Help
Entry
Celf_3566         CDS       T01490                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfi  Cellulomonas fimi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celf_3566
   01230 Biosynthesis of amino acids
    Celf_3566
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celf_3566
   00030 Pentose phosphate pathway
    Celf_3566
   00051 Fructose and mannose metabolism
    Celf_3566
   00052 Galactose metabolism
    Celf_3566
  Energy metabolism
   00680 Methane metabolism
    Celf_3566
Enzymes [BR:cfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celf_3566
Protein phosphatases and associated proteins [BR:cfi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Celf_3566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3993361..3994494)
Genome map
AA seq 377 aa AA seqDB search
MADGKVKRVGILTAGGDSPGLNAAIRGFGKAAIGAYGMELIGFRDGVTGLVENRSVPLDG
AALSGILTVGGTILGTSRDKVHRWVVDGEVRDMVPTVVENYHREGLDALVMLGGGGTAKN
AMKLVEAGLNVIHLPKTIDNDIARTDTTFGFATATEIATEAIDRVHSTAHSHHRIILTEI
MGHRAGWLTLGAGIAGGADIILIPEIPYTVESIAETIRARRARGSNFSVIAVAEGARDVG
DTADFEAARLLVKAAKTPEAVKAAKAHLAHVEDQQREHTFKLARELEAATSLESRVTILG
YVQRGGAPVAADRILATRLGAAAADALARGESGVMVAARGEGTELVPLAEVAGKVKLVPP
DHEWITAARQVGTGLGD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtggcggacggcaaggtcaagcgggtcggcatcctcaccgcgggcggcgacagccccggc
ctcaacgcggcgatccgcgggttcggcaaggcggcgatcggcgcctacggcatggagctc
atcgggttccgcgacggcgtgacgggtctcgtcgagaaccggtctgtcccgctcgacggc
gccgcgctgtccggcatcctcacggtcggcgggacgatcctcggcaccagccgcgacaag
gtgcaccggtgggtcgtcgacggcgaggtccgcgacatggtgccgaccgtcgtcgagaac
taccaccgcgagggcctggacgcgctggtcatgctgggcggcggcggcaccgcgaagaac
gcgatgaagctcgtcgaggcgggtctcaacgtcatccacctgccgaagacgatcgacaac
gacatcgcgcgcaccgacaccacgttcggcttcgcgaccgcgaccgagatcgcgaccgag
gcgatcgaccgcgtgcactccacggcccacagccaccaccggatcatcctcaccgagatc
atgggccaccgggccggctggctcacgctcggcgcgggcatcgcgggcggcgccgacatc
atcctcatccccgagatcccgtacaccgtcgagtcgatcgccgagacgatccgcgcccgc
cgcgcgcgcggctcgaacttcagcgtcatcgccgtcgccgagggtgcgcgcgacgtgggc
gacaccgccgacttcgaggcggcccggctgctggtcaaggccgcgaagacgcccgaggcg
gtcaaggccgcgaaggcgcacctcgcgcacgtcgaggaccagcagcgcgagcacaccttc
aagctggcccgtgagctcgaggccgcgacgtcgctggagagccgcgtgacgatcctcggc
tacgtgcagcgcgggggagcaccggtcgccgccgaccggatcctcgcgacccggctcggt
gcggccgcggccgacgcgctcgcgcgcggcgagtcgggcgtcatggtcgccgcccgcggg
gaggggaccgagctcgtcccgctcgccgaggtggccggcaaggtcaagctcgtcccgccg
gaccacgagtggatcaccgccgcccgtcaggtcggcacgggcctcggcgactag

DBGET integrated database retrieval system