KEGG   Colletotrichum fioriniae: CFIO01_04699Help
Entry
CFIO01_04699      CDS       T04796                                 

Definition
(GenBank) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
cfj  Colletotrichum fioriniae
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CFIO01_04699
   00500 Starch and sucrose metabolism
    CFIO01_04699
Enzymes [BR:cfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CFIO01_04699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
AA seq 681 aa AA seqDB search
MNALRACVREILEVKRRVYQYYPSQHSMSVLKGGAVFTAIASLAAVAVPASSASVPTITP
EYLATAGNNSLFTRWRPRSHYLAPHSWLNDPCGAVYDPATETYHLHYQFHPNHVNWGNIS
WAHAVSKDLFHWTDVRDWQNDSSVSLASGKYASGPLSQFTGTTQPVNIEGASDGTLLTFG
TGIHYLPTNWKQPYITGTEVQAMYTSSDGGSTWDEVGTVLSGPPEGWNVTGWRDPSFFPS
TELDSLLQVSEPHYYMVLGSGLKTGDVPAQLPGAARPGFIGPRIPLYSAPSSNLTQWTFL
GALWEPAANSSLGAPDITGSYGYNFEVSSFFDLPVGDSDEKAWFVTMGAEGGNTTQHWKE
QWALWNRGDVVRRDNGSVEFTPTAGAALDWGISYAQATWKDTRNADRRVMWGWANDDILG
DYGYNTSKQMGYQGSMNLPVELYIKETKGVQNCGTQQDGSTCIESCNGHTAQTLGMRPLP
DVLELLREGAQTNEFEIGQLTDTNKTASADLGTSYELTATLSDFSGSAGIILAQSPDSAE
YTTINFDVEASEISVIRTHSSLLPNFNNATFVGHFEPYQIHEKGANATVTEELNFHVVLD
NSLLEIWVNERFALTARIYPSRNDSTGLTFFAADGGKATWKDVKVWTGLAQAWPERPEDS
SVPLVWDTAEQTNNYTWWAGY
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccttgagggcctgcgttcgtgagattttggaggtcaagcggcgcgtctaccag
tactatccatcgcagcacagcatgtcagtcctcaagggtggtgccgtcttcacggccatc
gcctccctcgccgccgtcgcggtcccggcttcgtctgccagtgtcccgaccatcacgccc
gagtatctcgcgactgcgggcaacaactccctcttcacccgctggaggcctcgctctcac
tacctcgcgccgcacagctggctcaacgacccttgcggtgccgtctacgacccggccacg
gagacataccacttgcactaccagttccaccccaaccacgtcaactggggtaacatctca
tgggcccacgccgtctccaaggatctcttccactggactgatgtccgcgactggcaaaat
gactcttccgtgtcactcgcctccggcaagtacgcgtccggccctctctcacagttcacc
ggcaccacgcagcctgtcaacatcgagggcgccagcgatggcacactcctgacctttggt
accggtattcactacctgcctaccaactggaagcagccgtacatcaccggcaccgaagta
caagccatgtacacctcgtccgatggaggttctacatgggacgaagtcggcactgttctc
tctggacctcccgagggctggaacgtcaccggctggagagatcccagcttcttcccctcc
acggagctcgacagcctcctccaggtcagcgagccccactactacatggttctcggctcc
ggccttaagaccggcgatgtccccgcccagcttcccggcgccgcccgccccggtttcatc
ggcccccgtatccctctctactccgcgccgtcctccaacctgacccagtggactttcctc
ggagccctctgggagcctgccgcgaactcctccctcggtgcccccgatatcaccggatct
tacggctacaactttgaagtcagcagcttcttcgacctccccgtcggcgactcggacgag
aaggcctggttcgtcaccatgggcgccgagggtggtaacacaacacagcactggaaggag
caatgggctctctggaaccgcggagacgttgtccgccgcgacaacggctccgtcgagttc
acgccgaccgccggagccgccctggactggggtatctcctacgcccaagccacctggaag
gacactcgcaacgccgaccgacgcgtcatgtggggttgggccaacgacgatatcctcggt
gactacggctacaacacctccaagcagatgggttaccaaggttccatgaacctccccgtg
gaactctacatcaaggagaccaagggcgttcagaactgcggcacccagcaggacggaagc
acctgcatcgagagctgcaacggccacaccgcgcagaccctcggcatgcgccccctcccc
gacgtcctcgagctcctccgcgagggcgcgcagaccaatgagttcgagattggccagctt
accgacaccaacaagaccgcctccgctgacctcggcacttcctatgagctgactgccact
ctcagcgactttagcggctccgcgggtatcatcctcgcccagagccccgactccgccgag
tacaccaccatcaacttcgacgtcgaggcctcggagatcagcgtcatccgcacgcacagc
agtctcctgcccaacttcaacaacgccacgtttgtcggccacttcgagccttaccagatc
cacgagaagggcgccaacgcgaccgtcacggaggagctcaacttccacgttgtgctcgac
aactctctgctcgagatctgggtcaacgagcgcttcgcactgacggcgcgtatttacccc
tcgcgcaacgatagcacaggtctgaccttctttgctgcggatggcggcaaggctacctgg
aaggatgtaaaggtctggactggccttgcgcaggcgtggcctgagagaccggaggattcc
agcgttcccttggtttgggatactgctgagcagacgaacaactacacttggtgggccgga
tactag

DBGET integrated database retrieval system