KEGG   Colletotrichum fioriniae: CFIO01_09658Help
Entry
CFIO01_09658      CDS       T04796                                 

Definition
(GenBank) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cfj  Colletotrichum fioriniae
Pathway
cfj00052  Galactose metabolism
cfj00500  Starch and sucrose metabolism
cfj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfj00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CFIO01_09658
   00500 Starch and sucrose metabolism
    CFIO01_09658
Enzymes [BR:cfj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     CFIO01_09658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: EXF84530
UniProt: A0A010R755
AA seq 536 aa AA seqDB search
MTIRSVFLTTLVGVAQLTRQTLGQSTISSQPVNVPTGTPIVGDYNGAYRPQLHYSPPQHF
MNDPNGMFRGADGVWHLYYQYNPTGVVAGNQHWGHATSKDLYHWSNQPIALFPPEKDVFI
YSGSAVVDVNNTSGFFPGQDNGVVAIYTLASPTLQTQGIAYSRDGGYTFTPYANNPVINS
TSAQFRDPKVIRYNESWVMVVAYPHDFAIGIFTSPNLKDWTATSNFSHHGLLGLQYECPN
LISMPYMDTEGKRQDDMWLMAISINPGAPLGGSITEYYPGTFNGTHFEAVDAAARIADFG
KDNYAGQWFYGLPAEEFPVSIAWASNWQYAQTVPTDREGWRSIMSLPRQNYLTKAKRVGW
KLVSAPYNLEPVLGRELASHQSMGNGTLVVDYADVESNAIYWEVNVTGIPEKDISATASL
NFTFSSPATGEYINGGYFFGGDPVFFVNRNGARGFENIFFTERTSISSLTTEQNTWGLSG
VIDRSILEVFINGGIDSATNTFFTTEPLSRFVLSTTDLSNSMSVSVKVNGLESAWK
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcgaagcgtcttcttgacgacccttgtcggagttgcccagctcacgcggcaa
acacttggccaatcaactatttcttctcaacctgtcaatgttccaactggaacacccatc
gttggcgattacaatggtgcttatcgccctcaattgcactactctcctcctcaacatttc
atgaacgaccccaatggcatgttccgaggcgctgatggcgtttggcatttgtattaccag
tacaatcctacgggcgttgttgcgggtaaccagcattggggacacgcgacgtccaaagac
ttgtaccattggtcaaatcagcccatagctctctttccccccgaaaaggatgtctttatc
tactctggaagtgctgttgttgatgtaaacaatacatcgggcttcttcccaggccaagac
aatggtgtggtcgcaatctataccctggcatcgccgacactgcagactcagggcattgct
tattctcgagatggagggtacaccttcaccccgtatgcaaacaatcccgtcatcaatagt
acatcggcccagttccgcgatcccaaagtcatccgttacaacgagtcgtgggtcatggtg
gttgcctatccacatgactttgccatcggtattttcacgtctcccaacctgaaagattgg
acagctactagcaacttctcccatcatggtcttcttggtctgcagtatgagtgtccgaac
ctgatttctatgccttacatggatacagagggcaagaggcaggacgacatgtggcttatg
gccatcagcatcaacccaggtgcgcctctaggaggctctataacggagtactatcctggt
acatttaatggcactcactttgaggctgtggacgcggctgcgagaattgcagattttgga
aaagataattatgctggacaatggttctacggccttccggctgaagaattcccggtgtca
atcgcctgggcatccaactggcagtatgctcaaactgtcccgactgacagagagggctgg
cgaagcatcatgagtcttccgcgtcagaattatctgactaaggcgaagcgtgtgggatgg
aaactagtctcggccccctacaacttggagcccgtgctgggtcgtgaactcgcttcccac
cagagcatgggtaacgggacactagtcgttgactatgccgatgtggaatccaacgctatt
tactgggaggttaatgtgacaggcattccagagaaagatatctcggcaactgcctccttg
aactttacgttctcgagccctgctactggcgagtatatcaacggcggatacttcttcggc
ggagatccggtattttttgtcaaccgcaacggcgcccggggcttcgagaacattttcttc
acggagagaacatctattagcagtttgacaacagaacagaacacgtggggtctcagtgga
gtgattgataggtcgatcttggaggtcttcattaatggtggcatcgatagcgcgaccaac
acgttctttacgactgagccattgtcgcgctttgtgttgagtacaacggatctatctaac
agcatgagtgtgagcgtcaaggtaaatgggttagaaagcgcatggaaatag

DBGET integrated database retrieval system