KEGG   Cellulomonas flavigena: Cfla_0073Help
Entry
Cfla_0073         CDS       T01230                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cfl  Cellulomonas flavigena
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_0073
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cfla_0073
Enzymes [BR:cfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Cfla_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
92499..93857
Genome map
AA seq 452 aa AA seqDB search
MTAPTTQIDDLQGTPAAVAGAVPARPGDQTRTAEQLEHDWATDPRWSGIERRHTGADVVR
LRGSVREDPTLARRGAQRLWELLHTRTHVPALGALTGNQAVQQVRAGLEAIYLSGWQVAA
DANLSGQTYPDQSLYPANSVPAVVRRINNALMRADQIDVAENGRATREWLAPIVADAEAG
FGGPLNAYELMHAMIQAGAAGVHWEDQLAAEKKCGHLGGKVLVPTSQHVRTLSAARLAAD
VAGAPTVVIARTDSLGADLLTSDVDERDQEFLTGERTAEGYFRVRPGLDAVVSRATAYAP
YSDLIWVETSTPDVALAVEFAERIHEAFPGKLLAYNCSPSFNWRAHLDDAQIARFQRELA
GHGYAFQFITLAGFHALNESMFTLAKGYAERGMSAYVDLQTAEFAAEADGYTATRHQREV
GTGYFDQVATAISPDSATLALAGSTETAQFQH
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccaccacccagatcgacgacctgcagggcacccccgccgccgtcgcgggt
gcggtccccgcccgcccgggcgaccagacccgcaccgccgagcagctcgagcacgactgg
gccaccgacccccggtggtccggcatcgagcggcggcacaccggcgccgacgtcgtccgc
ctgcgcggctcggtccgcgaggacccgacgctcgcccgtcgcggcgcgcagcgtctctgg
gagctcctgcacacccgcacccacgtccccgcgctcggcgcgctgacgggcaaccaggcg
gtgcagcaggtccgcgcggggctcgaggcgatctacctgtcgggctggcaggtcgcggcc
gacgccaacctgtcgggccagacgtacccggaccagtcgctctacccggccaactccgtg
ccggccgtcgtccggcgcatcaacaacgcgctcatgcgcgccgaccagatcgacgtcgcg
gagaacgggcgggcgacgcgcgagtggctcgcaccgatcgtcgcggacgccgaggccggc
ttcggtggcccgctcaacgcgtacgagctcatgcacgcgatgatccaggcgggcgccgcc
ggtgtgcactgggaggaccagctcgcggcggagaagaagtgcggccacctgggcggcaag
gtgctcgtcccgacgtcgcagcacgtccgcacgctgtcggcggcgcggctcgcggccgac
gtcgcgggcgccccgacggtcgtcatcgcccgcacggactccctgggcgcggacctgctg
acgtccgacgtcgatgagcgcgaccaggagttcctcacgggcgagcgcaccgccgagggg
tacttccgggtccgtccgggcctcgacgcggtcgtctcccgcgccacggcgtacgcgccg
tactccgacctcatctgggtcgagacgtcgacgccggacgtcgcgctggccgtcgagttc
gccgagcggatccacgaggcgttccccggcaagctcctggcgtacaactgctcgccgtcg
ttcaactggcgcgcgcacctcgacgacgcccagatcgcgcgcttccagcgtgagctcgcg
ggccacgggtacgcgttccagttcatcaccctcgccgggttccacgccctcaacgagtcg
atgttcacgctcgccaagggctacgccgagcgcggcatgagcgcgtacgtcgacctgcag
acggccgagttcgccgccgaggccgacggctacaccgccacccgtcaccagcgggaggtc
ggcacgggctacttcgaccaggtcgccaccgcgatcagccccgacagcgccaccctcgcg
ctggccggctccacggagaccgcccagttccagcactga

DBGET integrated database retrieval system