KEGG   Cellulomonas flavigena: Cfla_0074Help
Entry
Cfla_0074         CDS       T01230                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cfl  Cellulomonas flavigena
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_0074
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cfla_0074
   00630 Glyoxylate and dicarboxylate metabolism
    Cfla_0074
Enzymes [BR:cfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Cfla_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94005..95672
Genome map
AA seq 555 aa AA seqDB search
MTIIDTSPVAANLTPAFSHPRLTITGPRVDGIDHVLTPEAMDFLTDLHQRFSGRRHELLL
ARQRRRDRFGNGADPDFLPLTAHIRADPTWRVAGPGPGLEDRRVEITGPTDRKMTVNALN
SGAKVWLADHEDAMSPTWSNAISGQVNLYDAIRGQIDFTSPEGKEYKVGETTPTIVFRPR
GWHLTEKHLRFTDRAGQSCAASASLVDAGLYLFHNAQALIDAGRGPYLYLPKIEGHLEAR
LWDDVFRFTETYLNLRHGTIRATVLIETITAAFEMEEILYELRDHCAGLNAGRWDYIFSV
IKNFRARGPRFVMPDRGKVTMTVPFMKAYTELLVQTCHKRGAQAIGGMSAFIPNRREPEV
TARALEQVRADKEREAGQGYDGTWVAHPDLVPVAREVFDAAFGDRTDQRHRLREDVRVTA
ADLLNVPSAGGGEPGAVTDAGLRQNVSVAVRYLEAWLRGSGAVAIDNLMEDAATAEISRS
QVWQWVHQGTVTAEGTRIDATTVEKVLADVLGSLERREGDRYDAAATLFREVSLSEDFPT
FLTIPAYTQHLVTPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgacacctcgcccgtggcggcgaacctgacccccgccttctcccacccc
cgcctgacgatcaccggcccgcgcgtcgacggcatcgaccacgtgctcacgccggaggcc
atggacttcctcaccgacctgcaccagcgcttctcgggccgtcggcacgagctgctgctg
gcccgccagcgccgccgggaccgcttcggcaacggcgccgacccggacttcctgccgctg
accgcgcacatccgcgcggacccgacgtggcgcgtcgccggccccggaccgggcctggag
gaccgccgcgtcgagatcaccggccccaccgaccgcaagatgaccgtcaacgccctgaac
tccggcgccaaggtgtggctcgccgaccacgaggacgccatgagccccacgtggtccaac
gcgatctccggccaggtcaacctgtacgacgcgatccgcgggcagatcgacttcacgtcg
cccgagggcaaggagtacaaggtcggtgagacgacgcccacgatcgtgttccgcccacgc
ggctggcacctcaccgagaagcacctgcgcttcacggaccgcgccgggcagtcctgcgcg
gcgtcagcgtcgctcgtggacgcgggcctgtacctgttccacaacgcgcaggcgctgatc
gacgccggccgcggcccgtacctctacctgcccaagatcgaggggcacctggaggcgcgg
ctgtgggacgacgtcttccggttcaccgagacctatctcaacctgcggcacggcacgatc
cgcgcgacggtcctcatcgagaccatcacggccgcgttcgagatggaggagatcctctac
gagctgcgcgaccactgcgcgggcctcaacgccgggcgctgggactacatcttcagcgtc
atcaagaacttccgcgcccgcggtccccggttcgtcatgccggaccgcggcaaggtgacc
atgacggtgccgttcatgaaggcgtacaccgagctgctcgtgcagacgtgccacaagcgc
ggcgcgcaggcgatcggcggcatgagcgcgttcatccccaaccgccgtgagcccgaggtg
accgcgcgggcgctggagcaggtgcgcgcggacaaggagcgcgaggccggccagggctac
gacgggacgtgggtcgcgcaccccgacctggtgccggtggcgcgcgaggtgttcgacgcg
gcgttcggcgaccgcaccgaccagcggcaccgcctgcgcgaggacgtccgcgtgaccgcc
gccgacctgctgaacgtgccgtccgcgggcggcggcgagccgggtgccgtcaccgacgcc
ggtctgcggcagaacgtgtccgtggccgtccggtacctcgaggcgtggctgcgcgggtcg
ggcgccgtggcgatcgacaacctcatggaggacgcggcgacggccgagatctcgcgctcg
caggtgtggcagtgggtgcaccagggcacggtgacggccgagggcacccgcatcgacgcg
acgaccgtcgagaaggtgctggcggacgtgctcggcagcctcgagcgacgcgagggcgac
cggtacgacgccgcggcgaccctgttccgcgaggtgtcgctgtcggaggacttcccgacg
ttcctcacgatccccgcctacacccagcacctggtgacgccggcctga

DBGET integrated database retrieval system