KEGG   Cellulomonas flavigena: Cfla_0074Help
Entry
Cfla_0074         CDS       T01230                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
cfl  Cellulomonas flavigena
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:cfl01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cfl00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:cfl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94005..95672
Genome map
AA seq 555 aa AA seqDB search
MTIIDTSPVAANLTPAFSHPRLTITGPRVDGIDHVLTPEAMDFLTDLHQRFSGRRHELLL
ARQRRRDRFGNGADPDFLPLTAHIRADPTWRVAGPGPGLEDRRVEITGPTDRKMTVNALN
SGAKVWLADHEDAMSPTWSNAISGQVNLYDAIRGQIDFTSPEGKEYKVGETTPTIVFRPR
GWHLTEKHLRFTDRAGQSCAASASLVDAGLYLFHNAQALIDAGRGPYLYLPKIEGHLEAR
LWDDVFRFTETYLNLRHGTIRATVLIETITAAFEMEEILYELRDHCAGLNAGRWDYIFSV
IKNFRARGPRFVMPDRGKVTMTVPFMKAYTELLVQTCHKRGAQAIGGMSAFIPNRREPEV
TARALEQVRADKEREAGQGYDGTWVAHPDLVPVAREVFDAAFGDRTDQRHRLREDVRVTA
ADLLNVPSAGGGEPGAVTDAGLRQNVSVAVRYLEAWLRGSGAVAIDNLMEDAATAEISRS
QVWQWVHQGTVTAEGTRIDATTVEKVLADVLGSLERREGDRYDAAATLFREVSLSEDFPT
FLTIPAYTQHLVTPA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcatcgacacctcgcccgtggcggcgaacctgacccccgccttctcccacccc
cgcctgacgatcaccggcccgcgcgtcgacggcatcgaccacgtgctcacgccggaggcc
atggacttcctcaccgacctgcaccagcgcttctcgggccgtcggcacgagctgctgctg
gcccgccagcgccgccgggaccgcttcggcaacggcgccgacccggacttcctgccgctg
accgcgcacatccgcgcggacccgacgtggcgcgtcgccggccccggaccgggcctggag
gaccgccgcgtcgagatcaccggccccaccgaccgcaagatgaccgtcaacgccctgaac
tccggcgccaaggtgtggctcgccgaccacgaggacgccatgagccccacgtggtccaac
gcgatctccggccaggtcaacctgtacgacgcgatccgcgggcagatcgacttcacgtcg
cccgagggcaaggagtacaaggtcggtgagacgacgcccacgatcgtgttccgcccacgc
ggctggcacctcaccgagaagcacctgcgcttcacggaccgcgccgggcagtcctgcgcg
gcgtcagcgtcgctcgtggacgcgggcctgtacctgttccacaacgcgcaggcgctgatc
gacgccggccgcggcccgtacctctacctgcccaagatcgaggggcacctggaggcgcgg
ctgtgggacgacgtcttccggttcaccgagacctatctcaacctgcggcacggcacgatc
cgcgcgacggtcctcatcgagaccatcacggccgcgttcgagatggaggagatcctctac
gagctgcgcgaccactgcgcgggcctcaacgccgggcgctgggactacatcttcagcgtc
atcaagaacttccgcgcccgcggtccccggttcgtcatgccggaccgcggcaaggtgacc
atgacggtgccgttcatgaaggcgtacaccgagctgctcgtgcagacgtgccacaagcgc
ggcgcgcaggcgatcggcggcatgagcgcgttcatccccaaccgccgtgagcccgaggtg
accgcgcgggcgctggagcaggtgcgcgcggacaaggagcgcgaggccggccagggctac
gacgggacgtgggtcgcgcaccccgacctggtgccggtggcgcgcgaggtgttcgacgcg
gcgttcggcgaccgcaccgaccagcggcaccgcctgcgcgaggacgtccgcgtgaccgcc
gccgacctgctgaacgtgccgtccgcgggcggcggcgagccgggtgccgtcaccgacgcc
ggtctgcggcagaacgtgtccgtggccgtccggtacctcgaggcgtggctgcgcgggtcg
ggcgccgtggcgatcgacaacctcatggaggacgcggcgacggccgagatctcgcgctcg
caggtgtggcagtgggtgcaccagggcacggtgacggccgagggcacccgcatcgacgcg
acgaccgtcgagaaggtgctggcggacgtgctcggcagcctcgagcgacgcgagggcgac
cggtacgacgccgcggcgaccctgttccgcgaggtgtcgctgtcggaggacttcccgacg
ttcctcacgatccccgcctacacccagcacctggtgacgccggcctga

DBGET integrated database retrieval system