KEGG   Cellulomonas flavigena: Cfla_0259Help
Entry
Cfla_0259         CDS       T01230                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cfl  Cellulomonas flavigena
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cfla_0259
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Cfla_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
298863..299795
Genome map
AA seq 310 aa AA seqDB search
MVDVVVLGQVGRDLVVRVDAVPAAGEAAPVRERVEVLGGKGANQGVACAQLGLATALVGV
VGDDRAADAVLERAVADGMDVGHVVRRAGATTALLLDVVADGGERRLLEHVPDDVLLRPD
DVRAAAGLVGRARAVLLQLQQPADALAPALGTARDALLVADGAPQDEGFRDTLLDRVHVL
RADEDEAALLLGDAPDGVDATVAAAHELVGRGPRVVALEAGDANVVAWAEGHVVVPLLGG
PPVDPTGGGDSFVAGLVAALLAGHDAATAAWWASTAAAATASRLGGRPDLDVARVAADAA
RHRREHETGH
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtggtggacgtcgtggtgctgggccaggtggggcgcgacctcgtcgtgcgggtggacgcc
gtgccggccgcgggtgaggccgcgcccgtccgcgagcgcgtcgaggtgctgggcggcaag
ggcgcgaaccagggggtcgcgtgcgcgcagctcggtctcgcgacggcgctcgtcggggtg
gtcggcgacgaccgtgccgccgacgccgtgctggagcgcgcggtcgccgacgggatggac
gtggggcacgtcgtgcggcgcgcgggggcgacgacggccctgctgctcgacgtcgtcgcg
gacggcggcgagcgtcgcctgctggagcacgtcccggacgacgtgctgctgcgcccggac
gacgtgcgcgcggcggccgggctggtgggccgcgcacgggccgtcctgctgcagctccag
cagcccgccgacgcgctggcccccgcgctcggcaccgcccgcgacgcgctgctggtggcg
gacggtgccccgcaggacgaggggttccgcgacacgctgctcgaccgggtgcacgtgctg
cgcgccgacgaggacgaggcggcactgctgctcggcgacgcacccgacggcgtcgacgcg
accgtcgccgcggcacacgagctcgtcggccgggggccgcgtgtcgtcgcgctcgaggcg
ggcgacgccaacgtggtcgcgtgggcggaggggcacgtcgtcgtcccgctgctgggcggg
ccgcccgtggacccgaccgggggcggggactcgttcgtcgccgggctggtcgccgcgctg
ctcgcggggcacgacgccgcgaccgccgcgtggtgggcgtcgacggctgccgccgccacc
gcgtcacgcctgggcgggcggcccgacctggacgtcgcacgcgtcgccgcggacgccgcg
cgccaccgccgggagcacgagaccgggcactga

DBGET integrated database retrieval system