KEGG   Cellulomonas flavigena: Cfla_0376Help
Entry
Cfla_0376         CDS       T01230                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cfl  Cellulomonas flavigena
Brite
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cfla_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
405016..406503
Genome map
AA seq 495 aa AA seqDB search
MITTSPRHRRARRVVSLLTTAGLVATAAVALAAPAHAGTTLGQSAAERGRYFGVAIAAGR
MNDGTYMGIVDREFDSIVAENEMKMDATEPNRNQFNFSNGDRIVNYALGKGKKVRGHTLA
WHAQQPGWMQNMSGQSLRDALLNHVSRVASYYRGKIHSWDVVNEAFADDGRGSRRDSNLQ
RTGNDWIEAAFRAARSADPGAKLCYNDYNTDGVNAKSTGVYNMVRDFKARGVPIDCVGFQ
SHLGTTVPSDYQANLQRFADLGVDVQITELDIQQGSNQANAYRQVVQACLAVSRCTGITV
WGVRDTDSWRTGANPLLFDGSGNKKAAYAAVLEALNAGGGNGGGNNGGGSSSVDTNAWYV
LVNRNSGKALDVYNLSTADGADIVQWSRNNGNQQQWQFVSSGNGSYRLKSRLSSKVLDVY
AKSTANGAEVVQWPDNNGANQQWNVSISNGYATLLNRNSGKALEVQGASTADGGNVVQYS
AWNGANQQWQLVKVG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgacctcaccccggcaccgccgggcccgccgggtggtgtccctgctcaccacc
gcggggctggtggccacggccgccgtcgccctggccgctcccgctcacgcggggacgacg
ctcgggcagtccgcggcggagcgcggacgctacttcggcgtcgcgatcgccgcggggcgc
atgaacgacggcacctacatgggcatcgtcgaccgcgagttcgactcgatcgtggccgag
aacgagatgaagatggacgccaccgagccgaaccgcaaccagttcaacttcagcaacggc
gaccggatcgtcaactacgcgctcggcaagggcaagaaggtgcgcggccacaccctggcg
tggcacgcccagcagcccggctggatgcagaacatgtccggccagtcgctgcgcgacgcg
ctgctcaaccacgtctcccgcgtcgcgtcctactaccgcgggaagatccactcgtgggac
gtcgtgaacgaggcgttcgccgacgacggccgcgggtcgcgccgtgactccaacctgcag
cgcaccggcaacgactggatcgaggccgcgttccgcgccgcccgcagcgccgacccgggc
gccaagctctgctacaacgactacaacaccgacggcgtcaacgcgaagtccacgggcgtc
tacaacatggtccgcgacttcaaggcccgcggcgtcccgatcgactgcgtcggcttccag
tcccacctgggcacgaccgtgccgagcgactaccaggcgaacctgcagcggttcgccgac
ctgggcgtcgacgtgcagatcaccgagctcgacatccagcagggctccaaccaggccaac
gcctaccggcaggtcgtccaggcgtgcctggccgtctcccgctgcacgggcatcaccgtg
tggggcgtgcgcgacaccgactcctggcgcaccggcgccaacccgctgctgttcgacggc
tcgggcaacaagaaggccgcctacgccgcggtgctcgaggccctcaacgccggcggcggc
aacggtggcggcaacaacggtgggggcagcagcagcgtcgacaccaacgcctggtacgtc
ctggtcaaccgcaacagcggcaaggccctcgacgtgtacaacctgtcgaccgcggacggc
gccgacatcgtgcagtggtcgcgcaacaacggcaaccagcagcagtggcagttcgtcagc
tcgggcaacgggtcctaccggctgaagtcccggctgtcgtcgaaggtgctggacgtctac
gccaagtcgacggccaacggcgccgaggtcgtccagtggcccgacaacaacggcgccaac
cagcagtggaacgtgtcgatcagcaacggctacgcgacgctgctcaaccggaactcgggc
aaggcgctggaggtgcagggcgcgtcgacggcggacggcgggaacgtcgtgcagtactcc
gcgtggaacggtgccaaccagcagtggcagctcgtgaaggtcgggtga

DBGET integrated database retrieval system