KEGG   Cellulomonas flavigena: Cfla_0628Help
Entry
Cfla_0628         CDS       T01230                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cfl  Cellulomonas flavigena
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cfla_0628
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cfla_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675377..676027
Genome map
AA seq 216 aa AA seqDB search
MGDAPVGTPGTPPASTITRTQGHGGRAIAPFDEERAARAVRELLLAVGEDPDREGLQETP
ARVARAYREIFAGLTMDARDVLTTTFDLGHEEMVIVRDIEVYSTCEHHLVPFHGVAHVGY
IPGADGRITGLSKLARLVDVYARRPQVQERLTSQVADALVEVLDPTGVLVVVECEHLCMS
MRGVRKPGSRTVTSAVRGQMRDVATRAEAMSLLTAR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacgcacctgtgggtacgccgggcacgccgccggcctcgacgatcacgcggacg
cagggccacggcgggcgcgcgatcgcaccgttcgacgaggagcgcgccgcgcgtgccgtg
cgcgagctgctcctggcggtcggcgaggacccggaccgcgagggcctgcaggagacgccg
gcgcgcgtcgcccgggcgtaccgcgagatcttcgcgggcctgacgatggacgcgcgcgac
gtgctgacgacgaccttcgacctcgggcacgaggagatggtcatcgtgcgggacatcgag
gtgtactccacgtgcgagcaccacctggtgccgttccacggcgtcgcgcacgtcggctac
atccccggtgcggacggtcgcatcacggggttgtcgaagctcgcgcggctcgtcgacgtg
tacgcgcgccgcccgcaggtgcaggagcgcctcacgtcccaggtcgccgacgcgctcgtc
gaggtgctcgacccgacgggcgtgctggtcgtcgtcgagtgcgagcacctgtgcatgtcg
atgcgcggcgtgcgcaagccgggctcgcgcacggtgacgtcggcggtgcgcggtcagatg
cgggacgtcgcgacgcgcgccgaggccatgagcctgctcacggcgcgctga

DBGET integrated database retrieval system