KEGG   Cellulomonas flavigena: Cfla_0628Help
Entry
Cfla_0628         CDS       T01230                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00790  Folate biosynthesis
cfl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cfla_0628
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cfla_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Lip_A_acyltrans
Motif
Other DBs
NCBI-ProteinID: ADG73540
UniProt: D5UIP1
Position
675377..676027
Genome map
AA seq 216 aa AA seqDB search
MGDAPVGTPGTPPASTITRTQGHGGRAIAPFDEERAARAVRELLLAVGEDPDREGLQETP
ARVARAYREIFAGLTMDARDVLTTTFDLGHEEMVIVRDIEVYSTCEHHLVPFHGVAHVGY
IPGADGRITGLSKLARLVDVYARRPQVQERLTSQVADALVEVLDPTGVLVVVECEHLCMS
MRGVRKPGSRTVTSAVRGQMRDVATRAEAMSLLTAR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgacgcacctgtgggtacgccgggcacgccgccggcctcgacgatcacgcggacg
cagggccacggcgggcgcgcgatcgcaccgttcgacgaggagcgcgccgcgcgtgccgtg
cgcgagctgctcctggcggtcggcgaggacccggaccgcgagggcctgcaggagacgccg
gcgcgcgtcgcccgggcgtaccgcgagatcttcgcgggcctgacgatggacgcgcgcgac
gtgctgacgacgaccttcgacctcgggcacgaggagatggtcatcgtgcgggacatcgag
gtgtactccacgtgcgagcaccacctggtgccgttccacggcgtcgcgcacgtcggctac
atccccggtgcggacggtcgcatcacggggttgtcgaagctcgcgcggctcgtcgacgtg
tacgcgcgccgcccgcaggtgcaggagcgcctcacgtcccaggtcgccgacgcgctcgtc
gaggtgctcgacccgacgggcgtgctggtcgtcgtcgagtgcgagcacctgtgcatgtcg
atgcgcggcgtgcgcaagccgggctcgcgcacggtgacgtcggcggtgcgcggtcagatg
cgggacgtcgcgacgcgcgccgaggccatgagcctgctcacggcgcgctga

DBGET integrated database retrieval system