KEGG   Cellulomonas flavigena: Cfla_0629Help
Entry
Cfla_0629         CDS       T01230                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cfl  Cellulomonas flavigena
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cfla_0629
Enzymes [BR:cfl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Cfla_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676039..676986
Genome map
AA seq 315 aa AA seqDB search
MDTRTGDHTAAPGGPRLTALPAHLRAPARTLVMGVVNVTPDSFSDGGRWFDPDAAVARGL
ALLDEGADLLDVGGESTRPGAPRVPAADELVRVLPVVERLVAHGAAVSVDTTRAAVAEQA
VERGAVLVNDVSGGMADPGMAAVVARTGAAYVAMHWRGPSDVMDDHDRYDDVVADVRREL
AQRVAVLRDAGVRDDQVVLDPGLGFAKTGESNWPLLARLPELLADGFPVLVGASRKRFLG
HLLAGPDGTPAPPEARDEATAAVTTLAAAAGAWAVRVHEVGASVAAVRVAARWRAAQGEA
TARRATSRAGQGGAR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgcggacgggcgaccacaccgcggcccccggtgggccgcggctgaccgcgctg
ccggcccacctgcgcgcacccgcgcggacgctcgtcatgggcgtcgtcaacgtcacgccg
gactccttctccgacggcggtcgctggttcgaccccgacgcggccgtcgcccgcgggctc
gcgctgctcgacgagggcgccgacctgctcgacgtcggcggcgagtccacccggcccggt
gcgccgcgggtgcccgcggccgacgagctcgtgcgcgtgctgcccgtcgtcgagcggctc
gtcgcgcacggcgcggccgtcagcgtcgacaccacccgcgcagcggtcgccgagcaggcc
gtcgagcgcggtgccgtgctcgtcaacgacgtctcgggcggcatggccgacccgggcatg
gcggccgtcgtcgcgcggaccggtgcggcgtacgtcgcgatgcactggcgggggccgtcg
gacgtgatggacgaccacgaccggtacgacgacgtggtcgcggacgtgcgccgcgagctc
gcccagcgtgtcgcggtgctgcgggacgccggagtgcgcgacgaccaggtcgtgctggac
ccgggtctcgggttcgccaagacgggggagagcaactggccgctcctggcgcgcctgccg
gagctgctggccgacggcttccccgtgctggtgggggcgagccgcaagcggttcctcggg
cacctgctggcgggtcccgacggcacacccgcgccccccgaggcgcgcgacgaggcgacc
gcggccgtcaccacgctggccgcggctgcgggagcatgggccgtgcgcgtgcacgaggtg
ggggcgtcggtcgccgcggtccgggtcgccgcgcgctggcgggccgcgcagggcgaggca
acggcacggcgcgcgacgtcgcgcgccggacaaggaggagcacggtga

DBGET integrated database retrieval system