KEGG   Cellulomonas flavigena: Cfla_0630Help
Entry
Cfla_0630         CDS       T01230                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
cfl  Cellulomonas flavigena
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cfla_0630
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cfla_0630
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     Cfla_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676983..678560
Genome map
AA seq 525 aa AA seqDB search
MNVQDDTYDEAGRRWDQIRLTGVSATGYHGVFAHERREGQTFVADVVLHVDTRRAAANDD
LAHTVDYGEVALLVAAVLSGEPVDLVETVAERIAATVLARPGVHAVDVAVHKPQAPITVP
FGDVVVSIRRDRSKLPAAEPYRPATGQVRRPADPEQQHPRTAPLPLTDVAPAFASVDVVH
ADPPSAATATSPFAPTSSDPVPSTPTPSSPFAPTSVGPVPSAPTPAAPVPAGPFAPPPAP
APLAAPPLPSHLPGPPPAAPAAPVTSPAGPDGPGSVVVGPAPTGAVPTGVVPAVGIAAGP
VPAHVPVPDAARTELMAPVTDVVDAEIVLDALDEPPAQPVRAVLALGSNIGPAQETLRQA
VADIAATPGVEVVAVSPLARTAAVGPEQPDFLNAVVLARTTLSPRDLLRAAHAVEDRHGR
ERHERWGPRTLDVDVIVHGDTLAVTDDLELPHPRAHERAFVLQPWAQIDPEAQLPGLGGG
PVAQLAATAPDRDGVRWMALDWLTAPVPAANPEPDNASQGEAHLP
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtgcaggacgacacgtacgacgaggcggggcggcggtgggaccagatccgcctc
acgggtgtgtccgccaccgggtaccacggggtgttcgcgcacgagcggcgcgaggggcag
acgttcgtggccgacgtcgtgctgcacgtcgacacgcgccgcgccgccgcgaacgacgac
ctggcgcacaccgtcgactacggcgaggtcgcgctgctcgtcgcggccgtcctgtcgggc
gagccggtggatctcgtggagaccgtcgccgagcggatcgcggccaccgtgctcgcgcgg
cccggcgtccacgccgtcgacgtcgcggtccacaagccgcaggcgcccatcaccgtgccg
ttcggggatgtcgtcgtctcgatccgccgcgaccgcagcaagctccccgcggccgagccc
taccggccggcgacgggtcaggtgcgccgcccggcggaccccgagcagcagcacccgcgc
accgcaccgctgccgctgacggacgtcgcgccggcgttcgcgtcggtggacgtggtgcac
gcggacccgccgtcggccgccacggcgacgagcccgttcgccccgacctcgtcggacccc
gtgccgtcgaccccgacgccgtccagcccgttcgcccccacgtcggtgggcccggtgccg
tcggccccgacaccggccgcgccggtcccggccggcccgttcgccccgccgcccgcgccc
gcgccgctcgccgcgccgccgctgccctcgcacctgccggggccgccgcccgccgcccct
gcggcgccggtgacgtcgcccgcgggccccgacgggccgggctccgtcgtcgtcggcccc
gctcccaccggtgccgtgccgacgggcgtcgtgccggcggtcgggatcgcggcgggcccc
gtccccgcgcacgtgccggtgcccgacgcggcgcgcaccgagctcatggccccggtgacg
gacgtcgtcgacgccgagatcgtcctcgacgcgctcgacgagccgcccgcgcagccggtg
cgcgccgtgctggcgctggggtcgaacatcggccccgcgcaggagaccctgcggcaggcc
gttgccgacatcgccgccacacccggcgtggaggtcgtcgcggtgtcgccgctggcgcgc
acggccgccgtcggcccggagcagcccgacttcctcaacgccgtcgtcctggcgcgcacc
acgctgtcgccgcgggacctgctgcgggccgcgcacgcggtcgaggaccggcacgggcgc
gagcgccacgagcgttgggggccgcgcacgctcgacgtcgacgtcatcgtgcacggcgac
acgctcgcggtgacggacgacctggagctgccgcacccccgcgcgcacgagcgggcgttc
gtgctgcagccctgggcgcagatcgaccccgaggcgcagctgccgggcctcggcggcggc
ccggtcgcgcagctcgcggccaccgcgcccgaccgtgacggtgtgcggtggatggcgctc
gactggctgacggctccggtgccggccgcgaacccggagccggacaacgcgagccagggc
gaggcgcacctgccgtga

DBGET integrated database retrieval system