KEGG   Cellulomonas flavigena: Cfla_0654Help
Entry
Cfla_0654         CDS       T01230                                 

Definition
phosphoglycerate mutase (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_0654
   01230 Biosynthesis of amino acids
    Cfla_0654
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_0654
  Energy metabolism
   00680 Methane metabolism
    Cfla_0654
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cfla_0654
Enzymes [BR:cfl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cfla_0654
Exosome [BR:cfl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cfla_0654
  Exosomal proteins of melanoma cells
   Cfla_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
709969..710709
Genome map
AA seq 246 aa AA seqDB search
MTYTLVLLRHGESEWNAKNLFTGWVDVPLSEKGIEEAKRGGTLLTDAGVLPDVVHTSLLR
RAITTANLALDAADRHWIPVKRSWRLNERHYGALQGKNKKETLDAYGEEQFMLWRRSYDV
PPPEIELGSEYSQDADPRYAGEPIPRTEALAQVLDRALPYWDAEIVPDLKAGKVVLVAAH
GNSIRSIVKYLDDVDEQTIAGINIPTGIPLLYELDEETLKPTNPGGTYLDPEAAKAAIAA
VANQGR
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaccctcgtgctgctccgccacggcgagagcgagtggaacgccaagaacctg
ttcaccggctgggtggacgtgcccctgtccgagaagggcatcgaggaggccaagcgcggc
gggacgctcctgaccgacgcgggcgtgctccccgacgtcgtgcacacgtcgctgctgcgc
cgcgcgatcacgaccgcgaacctcgcgctcgacgccgcggaccggcactggatccccgtg
aagcgctcgtggcgcctcaacgagcggcactacggcgcgctgcagggcaagaacaagaag
gagacgctcgacgcgtacggcgaggagcagttcatgctctggcgccgctcgtacgacgtc
ccgccgccggagatcgagctcggctcggagtactcccaggacgccgacccgcgctacgcg
ggcgagccgatcccgcgcaccgaggcgctcgcgcaggtcctcgaccgcgcgctgccctac
tgggacgccgagatcgtgcccgacctcaaggccggcaaggtcgtcctcgtcgccgcgcac
ggcaactcgatccgctcgatcgtcaagtacctcgacgacgtggacgagcagaccatcgcg
ggcatcaacatccccacgggcatcccgctgctgtacgagctggacgaggagacgctgaag
ccgacgaaccccggcggcacgtacctcgacccggaggccgccaaggccgcgatcgccgcg
gtggcgaaccagggtcgctga

DBGET integrated database retrieval system