KEGG   Cellulomonas flavigena: Cfla_0840Help
Entry
Cfla_0840         CDS       T01230                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cfl  Cellulomonas flavigena
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cfla_0840
   00052 Galactose metabolism
    Cfla_0840
   00500 Starch and sucrose metabolism
    Cfla_0840
   00520 Amino sugar and nucleotide sugar metabolism
    Cfla_0840
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cfla_0840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
914124..915503
Genome map
AA seq 459 aa AA seqDB search
MNGLALAQQKMRDGGVAATAVDVFTRFYGLLESGSTGLVREADVEPLADVPHLDDLRTDD
AAGAEALARTAVVKLNGGLGTSMGMDRAKSLLPVRGGRTFLDVIADQVLAARAATGARLP
LVLMNSFRTRDDSLAALASHPELAVDGVPMDFLQNREPKLLVDGLTPVTWEADPTLEWCP
PGHGDLYTALYASGVLDALLAAGFRYASVSNSDNLGATPDARVAGWFAASGAPFAAEVAR
RTPADRKGGHLVVRRSDGRIVLRESAQTAPEDADAAADIATHRYFNTNNLWLDLEALSAE
LARTGGVLDLPLIRNEKNVDPTDKTSPKVVQIESAMGAAIEVFDGAAVLEVGRERFLPVK
TTNDLLVLRSDVYDEDDAHRLVAAVEAPFVDLDPAHYALVGDFDAHVPHVPSLREATSLR
VRGDWTFGSGVRVVGDAVVEGDGGTVPDGATIDADGLHA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaacggactcgcgctcgcccagcagaagatgcgtgacggtggggtcgcggccacggcc
gtcgacgtgttcacccggttctacggactcctggagtccgggagcacgggactcgtgcgg
gaggcggacgtcgagccgctcgccgacgtcccgcacctcgacgacctgaggaccgacgac
gcggccggcgccgaggcgctcgcgcgcacggctgtcgtcaagctcaacggcggcctcggg
acgtcgatgggcatggatcgcgccaagtcgctgctgccggtgcgcggcggccgcacgttc
ctcgacgtcatcgccgaccaggtcctcgcggcccgcgccgcgacgggtgcacgcctgccg
ctcgtcctcatgaactcgttccgtacgcgcgacgactccctcgcggcgctcgcgtcgcac
cccgagctggccgtcgacggggtgcccatggacttcctgcagaaccgtgagcccaagctc
ctcgtcgacggcctgacgcccgtgacgtgggaggccgaccccacgctcgagtggtgcccg
cccggccacggcgacctctacaccgccctgtacgcgtccggggtcctcgacgccctgctg
gccgccgggttccggtacgcgtcggtctcgaactccgacaacctcggcgccacccccgac
gcgcgggtcgccggctggttcgccgcctcgggcgcgccgttcgcggcggaggtcgcgcgg
cgcacgcccgccgaccgcaagggcgggcacctcgtcgtgcggcgctccgacggacggatc
gtgctgcgggagtccgcgcagacggcccccgaggacgccgacgccgcggccgacatcgcg
acgcaccggtacttcaacacgaacaacctgtggctggacctcgaggcgctctccgccgag
ctggcccgcacgggcggcgtgctggacctgccgctcatccgcaacgagaagaacgtcgac
ccgaccgacaagacgtcgccgaaggtcgtgcagatcgagtccgccatgggcgccgcgatc
gaggtgttcgacggcgccgccgtgctggaggtcggccgcgagcgcttcctccccgtgaag
acgacgaacgacctgctggtgctgcgctccgacgtgtacgacgaggacgacgcgcaccgt
ctggtcgcggccgtcgaggcgccgttcgtcgacctcgacccggcgcactacgcgctcgtc
ggcgacttcgacgcgcacgtgccgcacgtgccgtcgctccgggaggcgacgtcgctgcgc
gtgcggggcgactggacgttcggcagcggcgtgcgggtcgtcggggacgcggtggtcgag
ggcgacgggggaacggtgccggacggcgcgacgatcgacgcggacggactgcacgcctga

DBGET integrated database retrieval system