KEGG   Cellulomonas flavigena: Cfla_1016Help
Entry
Cfla_1016         CDS       T01230                                 

Definition
succinate dehydrogenase hydrophobic anchor subunit-like protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
cfl  Cellulomonas flavigena
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_1016
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cfla_1016
   00650 Butanoate metabolism
    Cfla_1016
  Energy metabolism
   00190 Oxidative phosphorylation
    Cfla_1016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1125613..1126071)
Genome map
AA seq 152 aa AA seqDB search
MSAIADPKAPRASRPGPSRRTTRGNFELYGWMFMRGSGVVLVVLIFGHLFVNLMVGEGIS
AIDFGFVAGKWASPFWQVWDLLMLWLAMLHGTNGVRTIINDYAEKDTTRLVLKLALYVAT
TLVIVLGTLVIFTFDPCPPNSPADLLPSFCTA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccatcgccgatcccaaggccccgcgcgcctcgcgcccgggcccgtcgcgccgc
accacgcgcggcaacttcgagctgtacggctggatgttcatgcgcgggtcgggcgtcgtc
ctggtcgtgctgatcttcggccacctgttcgtcaacctcatggtcggcgagggcatcagc
gcgatcgacttcggcttcgtcgcgggcaagtgggcgtcgccgttctggcaggtctgggac
ctgctgatgctgtggctcgcgatgctgcacggcaccaacggcgtgcggacgatcatcaac
gactacgccgagaaggacaccacgcgtctggtgctcaagctcgcgctgtacgtcgccacc
acgctcgtcatcgtgctcggcacgctcgtgatcttcacgttcgacccgtgcccgccgaac
agcccggccgacctgctgccgtccttctgcacggcctga

DBGET integrated database retrieval system