KEGG   Cellulomonas flavigena: Cfla_1025Help
Entry
Cfla_1025         CDS       T01230                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
cfl  Cellulomonas flavigena
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cfl00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1135266..1136561
Genome map
AA seq 431 aa AA seqDB search
MSEPFDAVDVIVAKRDGRRLSDAQIDWVIDAYTRGAVADEQMSALAMAILLNGMDRAEIA
RWTAAMIASGERMDFAGLSRPTADKHSTGGVGDKITLPLAPLVAVFDVAVPQLSGRGLGH
TGGTLDKLESIPGWRAALSNDEMLRQLNDVGAVICQAGSGLAPADRKLYALRDVTGTVEA
IPLIASSIMSKKIAEGTGSLVLDVKVGSGAFMKDAERAGELARTMVELGTDAGVRTVALL
TDMSVPLGLTAGNALEVRESVEVLAGGGPADVVELTVALAREMLDAAGRPDADPAAALAD
GRAMDVWRRMVAAQGGDPDAPLPWARETEQVLSPADGVLTTLDAYAVGVAAWRLGAGRAR
KEDPVQAGAGVEIHARPGDAVRAGQPLLTLHTDTPERFTRAREALVDGVVVDPAGTPGAR
GALVLDRVAAG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgttcgacgccgtcgacgtcatcgtcgccaagcgcgacgggcgtcggctg
agcgacgcgcagatcgactgggtgatcgacgcgtacacgcgcggtgcggtggccgacgag
cagatgagcgcgctggcgatggcgatcctgctcaacggcatggaccgtgcggagatcgcg
cgctggacggccgcgatgatcgccagcggcgagcgcatggacttcgcgggcctgtcgcgc
ccgacggcggacaagcactcgaccggtggtgtcggcgacaagatcacgctgccgctcgcg
ccgctcgtcgcggtcttcgacgtcgcggtgccgcagctgtcgggccgcggcctgggccac
acgggcggcacgctcgacaagctcgagtcgatccccgggtggcgcgccgccctgagcaac
gacgagatgctgcgccagctcaacgacgtgggcgcggtcatctgccaggccggttccggg
ctggcgcccgcggaccgcaagctctacgcgctgcgggacgtcaccggcacggtcgaggcg
atcccgctgatcgccagctcgatcatgagcaagaagatcgccgagggcacggggtcgctg
gtgctcgacgtcaaggtcggctcgggcgcgttcatgaaggacgccgagcgcgcgggcgag
ctggcgcgcaccatggtcgagctcggcacggacgcgggcgtgcggacggtcgcgctgctg
accgacatgtccgtgccgctgggcctgacagcgggcaacgcgctcgaggtgcgcgagtcc
gtcgaggtgctcgcgggcggcgggccggcggacgtcgtcgagctcacggtcgccctcgcg
cgcgagatgctcgacgctgccgggcgtcccgacgcggaccccgcggctgcgctcgccgac
ggtcgcgcgatggacgtgtggcgccgcatggtcgcggcgcagggcggcgacccggacgcg
ccgctgccgtgggcgcgcgagaccgagcaggtcctctcgccggccgacggcgtgctgacg
acgctcgacgcgtacgccgtgggcgtcgccgcgtggcgcctgggcgcgggccgcgcgcgc
aaggaggaccccgtgcaggcgggcgcgggtgtcgagatccacgcgcgccccggggacgcc
gtgcgcgcgggccagccgctgctcacgctccacaccgacacccccgagcggttcacgcgc
gcgcgcgaggcgctggtggacggcgtcgtcgtcgacccggccgggaccccgggtgcacgg
ggagcgctcgtcctcgaccgcgtcgccgcgggctga

DBGET integrated database retrieval system