KEGG   Cellulomonas flavigena: Cfla_1049Help
Entry
Cfla_1049         CDS       T01230                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cfla_1049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_1049
   00620 Pyruvate metabolism
    Cfla_1049
   00650 Butanoate metabolism
    Cfla_1049
  Lipid metabolism
   00071 Fatty acid degradation
    Cfla_1049
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cfla_1049
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cfla_1049
   00626 Naphthalene degradation
    Cfla_1049
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cfla_1049
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cfla_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1161352..1164111)
Genome map
AA seq 919 aa AA seqDB search
MSETTKKSTRAKAPAGASAEAPAAAAQPAGVALGVSEADAVAQSVDLLVANATKALAEFE
SMTQEDVDRFVKKGAVAALDQHGQLAKLAVEETGRGVFEDKAVKNIFACEHVTNSMANLR
TVGVINVDDLNGITEIAEPVGVIAGITPVTNPTSTAIFKALISLKTRNPIIFAFHPNAQQ
CSVAAARIVRDAAVAAGAPEHCIQWVEAPSLAATGALMNHPGVATILATGGNAMVKAAYS
CGKPALGVGAGNVPAYVEKSAKLARAINDIVLSKAFDNGVICASEQAAILDDEIYDAAMA
EFAKLHAYRATPAEKAKLERFIFGVEADGENCAGAKLNPAVVGKSPVWIAEQAGFTVPAD
TSIILAEVSGVGPAEPLTREKLCPVLAVLRASSTEEGIALAEKMVEFDGLGHSAAIHTLD
EALTVEFGRRVKAIRVICNAPSSLGGIGDIYNAFIPSLTLGCGSYGHNSVSNNVSAVNLV
NVKRVGRRNNNLQWFKVPAKTYFEPNAIRYLADMADVERVTIVTDATMTTLGFVDKVLDV
LRRRGNNVAVQIIDQVEPEPSVKTVQAGAAQMRHFRPDTIIALGGGSPMDAAKVMWLLYE
HPEIVFSDLKQKFFDVRKRAFKFPVLGDLAKLVCIPTTSGTGAEVTPFAVISDVEAGKKY
PLADYALTPTVAIIDPVLTHKMPRSLAADSGFDALTHATEAYVAVYANDFTDGMALQAIR
LIFDNLAQSVNGDPSDPLTQDAREKMHNAGTIAGMAFGNAFLGIVHAMAHVVGSTYHLVH
GRTNATLLPHVIRYNGTVPTKLTSWPKYESYVAPERFQQIAAMLGLPASTPEEGVESYAL
AVEALRAKVGIPQSFQAQGVDEQEFMSRLDEVAMGAYEDQCAPANPRMPMIDDMKDIMTA
AYYGTSLEDVRGRRERAEG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgagaccaccaagaagagcacccgcgcgaaggcccccgccggcgcgtcggccgag
gcccccgcggcggccgcgcagcccgccggcgtcgccctcggcgtgagcgaggccgacgcg
gtcgcgcagtccgtcgacctgctcgtcgcgaacgccaccaaggcgctcgccgagttcgag
tccatgacgcaggaggacgtcgaccgcttcgtcaagaagggcgccgtcgcggccctcgac
cagcacggtcagctggccaagctggccgtcgaggagaccgggcgcggtgtcttcgaggac
aaggccgtgaagaacatcttcgcgtgcgagcacgtcacgaactcgatggcgaacctgcgg
accgtcggcgtcatcaacgtcgacgacctcaacggcatcaccgagatcgcggagcccgtg
ggcgtgatcgccggcatcacccccgtcaccaaccccacgtcgaccgcgatcttcaaggcg
ctcatctcgctgaagacccgcaacccgatcatcttcgcgttccacccgaacgcccagcag
tgctccgtggccgccgcccgcatcgtgcgcgacgccgccgtggccgccggcgcccccgag
cactgcatccagtgggtcgaggccccgtcgctcgccgcgaccggtgccctcatgaaccac
ccgggtgtcgccaccatccttgcgaccggcggcaacgcgatggtcaaggccgcgtactcc
tgcggcaagcccgccctgggcgtcggcgccggcaacgtcccggcgtacgtcgagaagtcc
gccaagctcgcccgcgcgatcaacgacatcgtgctgagcaaggcgttcgacaacggcgtg
atctgcgcctccgagcaggccgccatcctcgacgacgagatctacgacgccgcgatggcg
gagttcgcgaagctccacgcgtaccgcgccaccccggcggagaaggcgaagctcgagcgc
ttcatcttcggtgtcgaggccgacggcgagaactgcgcgggagccaagctcaacccggcg
gtcgtcggcaagtcgccggtgtggatcgccgagcaggcgggcttcacggtccccgcggac
acctcgatcatcctggccgaggtgtcgggcgtcggccccgccgagcccctgacccgcgag
aagctgtgcccggtcctggccgtgctgcgggcgtcgtcgaccgaggagggcatcgcgctc
gccgagaagatggtcgagttcgacggtctgggccactcggcggccatccacacgctcgac
gaggcgctcacggtcgagttcggccggcgcgtcaaggcgatccgcgtcatctgcaacgcg
ccctcgtcgctcggcggcatcggtgacatctacaacgcgttcatcccgtcgctcacgctc
ggctgcggctcctacggccacaactcggtgtccaacaacgtgtcggccgtcaacctcgtc
aacgtcaagcgcgtgggccggaggaacaacaacttgcagtggttcaaggtccccgccaag
acgtacttcgagccgaacgcgatccgctacctcgcggacatggccgacgtcgagcgcgtc
acgatcgtcaccgacgcgaccatgacgaccctcgggttcgtcgacaaggtcctcgacgtg
ctgcgccgccgcggcaacaacgtggccgtgcagatcatcgaccaggtcgagcccgagccg
tccgtgaagaccgtccaggccggcgccgcgcagatgcgccacttccggcccgacacgatc
atcgcgctcggcggtgggtcgcccatggacgccgcgaaggtcatgtggctgctgtacgag
cacccggagatcgtcttctccgacctcaagcagaagttcttcgacgtccgcaagcgcgcg
ttcaagttcccggtgctgggcgacctggccaagctcgtgtgcatccccaccacgtcgggc
acgggcgccgaggtcacgccgttcgccgtcatcagcgacgtcgaggcggggaagaagtac
ccgctcgccgactacgcgctgacgccgaccgtcgcgatcatcgacccggtcctcacgcac
aagatgccgcggtcgctggccgccgactccgggttcgacgccctgacgcacgccaccgag
gcgtacgtcgcggtgtacgcgaacgacttcaccgacggcatggcgctgcaggcgatccgc
ctgatcttcgacaacctcgcgcagtcggtgaacggcgacccgagcgacccgctcacgcag
gacgcgcgggagaagatgcacaacgccgggacgatcgccggcatggcgttcggcaacgcg
ttcctcggcatcgtgcacgccatggcgcacgtcgtcggctcgacgtaccacctggtgcac
ggccgcacgaacgccaccctgctgccgcacgtgatccgctacaacggcaccgtcccgacc
aagctcacgagctggccgaagtacgagtcctacgtggcgcccgagcgcttccagcagatc
gcggcgatgctcggcctgccggcctcgacgcccgaggagggcgtggagtcctacgcgctg
gccgtcgaggcgctgcgcgccaaggtcggcatcccgcagtcgttccaggcacagggcgtc
gacgagcaggagttcatgagccggctcgacgaggtcgccatgggcgcctacgaggaccag
tgcgccccggcgaacccgcgcatgccgatgatcgacgacatgaaggacatcatgaccgcg
gcctactacggcacgtcgctggaggacgtgcgtggtcgccgcgagcgggcggagggctga

DBGET integrated database retrieval system