KEGG   Cellulomonas flavigena: Cfla_1056Help
Entry
Cfla_1056         CDS       T01230                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cfla_1056
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cfla_1056
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cfla_1056
Enzymes [BR:cfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cfla_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1172059..1173150
Genome map
AA seq 363 aa AA seqDB search
MAHQWRGVIAEYADRLPAYVQERIVTLGEGGTPLVHAPVLSQRTGAEVHVKVEGMNPTAS
FKDRGMTTAISAAAARGAKAVVCASTGNTSASAAAYATRAGMVCAVLVPDGKIAMGKLSQ
AIAHGAHLLQVDGNFDDCLIAARKLAEAYPVELVNSVNPARIEGQKTAAFEIVDALGDAP
DIHCLPVGNAGNITAYWKGYREYAGLDDGAGLPAVATRTPVMWGFQAAGAAPIVLGHPVD
APETIATAIRIGNPASWQQAEEARDVSGGVIESVTDEQILAAHRVLSAEVGVFVEPASAA
GVAGLLACAERGLVPAGTRVVVTVTGHGLKDPQWALRTADGGEVRPQRVTTDVVTIADAL
GLG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccagtggcgcggcgtcatcgccgagtacgccgaccgtctgcccgcctacgtc
caggagcgcatcgtcacgctgggggagggcggcacgccgctcgtccacgcccccgtcctg
tcgcagcgcacgggcgccgaggtccacgtcaaggtcgagggcatgaacccgaccgcgtcg
ttcaaggaccgcggcatgacgacggcgatctccgccgccgcggcgcgcggcgcgaaggcc
gtggtgtgcgcgtcgacgggcaacacgtcggcctcggccgcggcctatgcgacgcgtgcc
ggcatggtctgcgcggtcctcgtgccggacggcaagatcgccatgggcaagctcagccag
gccatcgcgcacggcgcgcacctgctgcaggtcgacggcaacttcgacgactgcctgatc
gccgcgcgcaagctcgccgaggcgtacccggtcgagctcgtcaactcggtgaacccggcc
cgcatcgaggggcagaagacggcggcgttcgagatcgtcgacgcactcggcgacgccccc
gacatccactgcctgcccgtcggcaacgccggcaacatcaccgcgtactggaagggctac
cgcgagtacgcgggcctggacgacggcgccggcctgccggcggtcgcgacgcgcacgccc
gtgatgtggggcttccaggcggccggcgccgcgccgatcgtcctcggccacccggtcgac
gcacccgagacgattgcgacggcgatccgcatcggcaaccctgcgtcctggcagcaggcc
gaggaggcgcgcgacgtgtccggcggcgtcatcgagtcggtgaccgacgagcagatcctc
gccgcgcaccgcgtgctgtcggccgaggtcggcgtgttcgtcgagcccgcgtcggccgcg
ggcgtcgcaggtctgctggcatgcgccgagcgcgggctggtgcccgcgggtacgcgggtc
gtcgtcacggtcacgggtcacggcctgaaggacccgcagtgggcgctgcggacggcggac
ggcggcgaggtacggccgcagcgtgtgacgaccgacgtcgtgacgatcgccgacgcgctc
ggcctgggctga

DBGET integrated database retrieval system