KEGG   Cellulomonas flavigena: Cfla_1094Help
Entry
Cfla_1094         CDS       T01230                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cfl  Cellulomonas flavigena
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cfla_1094
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cfla_1094
   00600 Sphingolipid metabolism
    Cfla_1094
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Cfla_1094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1217566..1219758
Genome map
AA seq 730 aa AA seqDB search
MPQRPDETMSTPCDPQGGARPPELLHLRAAGVSLVLDLAGMPRVLHWGADLGDLDDAALA
DLRLAVRPAPAGFPVDGEVVPSVLPSQAEGWLGTPGLTGSRAGRSWSPRFAAGTPSLTSG
DDGGAVLVVPAADPATGLELELVVELTPQGLVRQRATLTSTGGDPYEVGGLLLMLPVPAR
ATTLLDFGGHWARERAPQRTAFTHGTRLRENRRGRTGFDTPYVLVAGTDDLGHRRGEAWG
WHVAWSGNHRTVAERSHHHAGLLGGGELLGPGEVRLAAGESYTSPWVYGSYGEDGLDAVA
ARFHGWLRARPQHPRSPRPVTLNTWEAVYFDHDLVRLTELADAAAEVGAERFVLDDGWFG
SRRDDTSGLGDWYVSDEVWPDGLGALIEHVTARGMQFGLWVEPEMVNPDSDLARAHPDWV
LRLPDRLPRPARSQQVLDLARPEAFAHVLERLDALLTENDIAYLKWDHNRDLVDAGHGPD
GVPGVHGQTLAVYRLLDALRARHPRVEIESCSSGGARVDLEILQRTDRVWASDCIDALER
RSIQWWTNLLIPLELMGAHVGSSASHVTGRTASLGFRAGTALFGHLGIEWDLQQADADQR
AELASWVALYKDVRGLLHTGASVHADGADPAVQVHGVVAQDGSDALFTIASIASSAQMPA
GTVALPGLDPAATYHVRPQEPGGGSRGGWPTPWWGPEGIRTTGRVLAKVGVRAPHLAPEQ
LVLVRATRVD
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
gtgccccagcgtcccgacgagacgatgtccacgccgtgcgacccgcagggcggcgcgcgg
ccgcccgagctcctgcacctgcgggccgcaggcgtcagcctcgtcctcgacctcgcgggg
atgccgcgcgtgctgcactggggtgccgacctcggtgacctcgacgacgctgcgctggcg
gacctgcggctcgccgtgcggccggcacccgcggggttccccgtcgacggcgaggtcgtg
ccctccgtgctgccgtcgcaggccgaggggtggctggggacccccggcctcaccggatca
cgcgccgggcgttcgtggtccccgcgcttcgcggcgggcacaccgtcactgacgtccggc
gacgacggcggcgcggtgctcgtggtcccggctgccgacccggcgacaggcctggagctg
gagctcgtcgtggagctcacgccgcaggggctggtgcggcagcgggcgaccctcacgagc
accgggggcgacccgtacgaggtcggcggtctgctgctcatgctccccgtgcccgcgcgg
gccacgaccctcctggacttcggcgggcactgggcgcgggagcgcgcgccgcagcgcacg
gcgttcacgcacggcacacggctgcgcgagaaccgccgcggccgcacgggcttcgacacc
ccgtacgtgctggtcgccggcacggacgacctggggcaccggcgtggtgaggcctggggg
tggcacgtcgcgtggtccggcaaccaccggacggtcgccgagcgcagccaccaccacgca
ggcctgctgggcggcggtgagctgctgggaccgggcgaggtgcggctggccgcgggggag
tcgtacacgagcccgtgggtctacgggtcgtacggcgaggacgggctcgacgcggtcgcg
gcgcggttccacggctggttgcgggcacgtccgcagcacccgcgcagcccgcgccccgtc
accctgaacacgtgggaggcggtgtacttcgaccacgacctcgtgcggctcacggagctc
gccgacgcggcggcggaggtcggtgccgagcgcttcgtgctcgacgacggatggttcggc
tcccgtcgcgacgacaccagcggcctgggcgactggtacgtctccgacgaggtgtggccc
gacggcctcggggcgctgatcgagcacgtcacggcgcgggggatgcagttcgggctgtgg
gtcgagcccgagatggtcaacccggactcggacctcgcgcgggcccaccccgactgggtg
ctccgcctgccggaccggctgccgcggcccgcacgctcgcagcaggtgctcgacctggca
cgcccggaggcgttcgcccacgtcctcgagcggctcgacgcgctgctcaccgagaacgac
atcgcgtacctcaagtgggaccacaaccgcgacctcgtcgacgcagggcacggccccgac
ggtgtccccggtgtgcacgggcagacgctcgccgtctaccgcctgctcgacgcgctgcgc
gcgcggcacccgcgcgtcgagatcgagtcgtgctcgtccggcggggcgcgggtcgacctg
gagatcctgcagcgcaccgaccgcgtgtgggcgtcggactgcatcgacgcgctcgagcgc
cgctcgatccagtggtggacgaacctgctgatcccgctcgagctcatgggggcgcacgtc
gggtcctccgcctcccacgtgaccgggcgcaccgcgtcgctcgggttccgggccggcacc
gccctcttcggccacctcggcatcgagtgggacctgcagcaggcggacgccgaccagcgc
gccgagctcgcgtcgtgggtcgcgctgtacaaggacgtgcgcgggctgctccacaccggc
gcgagcgtgcacgcggacggcgccgacccggcggtccaggtgcacggcgtggtcgcgcag
gacgggagcgacgcactgttcacgatcgcgagcatcgcgtcgtccgcgcagatgcccgcg
ggcaccgtcgcgctgcccggtctggacccggcggcgacgtaccacgtgcgcccgcaggag
ccgggcggcgggtcgcgcggcggctggccgacgccgtggtggggccccgagggcatccgg
accacgggacgggtgctggcgaaggtcggtgtacgggcaccgcacctggcgccggagcag
ctcgtcctggtgcgggcgacgcgcgtggactga

DBGET integrated database retrieval system