KEGG   Cellulomonas flavigena: Cfla_1348Help
Entry
Cfla_1348         CDS       T01230                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cfl  Cellulomonas flavigena
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:cfl00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1493770..1494369)
Genome map
AA seq 199 aa AA seqDB search
MKSALVVVDVQNDFCEGGSLAVAGGAAVAARISDYLRRHGAEYDTIVATRDWHAPLPDTN
DGHFAAPGTEPDYVTTWPVHCVAGTPGAEYHPDLVLPERTVHVVKGESRQDYSGFQGRVV
DADGPAQLGALLHARDIACVDVVGIATDFCVAATATDARRAGATVVTVLTDLTAAVSAPT
AVRALTDLTAQRIRLEESR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcgccctcgtcgtcgtcgacgtccagaacgacttctgcgagggcgggtccctc
gccgtcgccggcggagcggccgtcgccgcgcgcatcagcgactacctgcgccgccacggt
gccgagtacgacacgatcgtcgcgacgcgcgactggcacgctcccctgcccgacaccaac
gacggccacttcgccgcgccgggcaccgagcccgactacgtcaccacgtggcccgtgcac
tgcgtcgccggcacccccggtgcggaataccacccggacctggtgcttcccgagcgcacc
gtgcacgtcgtcaagggcgagtcgcggcaggactactcgggtttccagggccgcgtcgtc
gacgccgacgggcctgcgcagctcggcgcgctgctgcacgcccgggacatcgcgtgcgtg
gacgtcgtcggcatcgccaccgacttctgcgtggccgccaccgcgaccgacgcgcggcgc
gcgggcgcgacggtcgtcaccgtcctcaccgacctgacggccgccgtctccgcacccacg
gccgtcagggccctcaccgacctcaccgcgcagcggatccgtctcgaggagtcgcgatga

DBGET integrated database retrieval system