KEGG   Cellulomonas flavigena: Cfla_1369Help
Entry
Cfla_1369         CDS       T01230                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cfl  Cellulomonas flavigena
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cfl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518863..1520989
Genome map
AA seq 708 aa AA seqDB search
MPETTRHEDLWRLAAAYDVVPRYQGHDGDEHEASDETVVRVLAALGVDASSPERVELALA
HVENMPWRRVLPPVVVLREGAAVQVPVHVTHGDPVDVWLELDAEAGGGRREVTQVDVVVE
PRTVDGRLVGRATFELPTDLPLGWHEIRADGPSAHAHSPVVVTPHRLELPERLREGGVWG
LMPQLYSVRSRRSWGVGDLADLAELGWLAAHRWKADFLLVNPLHAAEPVEPLTPSPYLPT
TRRFVNPLYVRVEDVPETAYLSAADRALVEWAAEPVLGLAAEPGPIDRDVAWAAKRAALE
VVHAHPLAPARQAAFDAYVEEEGEGLREFALWCALVERHGPPAGWSDELHDPLSDAVAAA
AVELADRVAFWSWLQWVADEQLEHAQRVARDSGMALGIMHDLAVGVHPEGADAWALRDVL
ATGASVGAPPDMYNQQGQDWSQPPWHPDALARAAYRPYRDMLRTVLRHAGAIRIDHVIGL
FRLWWVPVGNGAKDGAYVRYDHEALVGILALEAHRAGAVVIGEDLGTVEPWVRDYLDDRG
ILGTSVLWFEQEHDGRPRPPESYRHRALATVTTHDLPPTAGYLAGEHVALRDRLGLLTEP
VATVRAHAAAERERMLDALRERGLLGHDPSEREIVEALHRWVRATPAVLLGVSLADAVGE
RRAQNQPGTDQEYPNWKVPLADGTGRPVLLDDLFTHARAQSLADAMGS
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagacgaccagacacgaggacctgtggcgcctcgccgccgcgtacgacgtcgtg
ccgcggtaccaggggcacgacggggacgagcacgaggcgtcggacgagacggtcgtgcgc
gtgctggccgcgctgggcgtcgacgcgtcgtcacccgagcgggtcgagctggcgctcgcg
cacgtcgagaacatgccgtggcggcgcgtgctgccgcccgtcgtggtgctccgcgagggg
gccgcggtgcaggtcccggtgcacgtgacgcacggtgacccggtggacgtgtggctcgag
ctcgacgccgaggcgggcggcgggcggcgcgaggtcacgcaggtcgacgtcgtcgtggaa
ccgcgcaccgtcgacggccggctcgtgggccgcgcgacgttcgagctccctaccgacctg
ccgctcggttggcacgagatccgcgcggacggccccagtgcgcacgcgcacagccccgtc
gtcgtcacgccgcaccgcctcgagctcccggagcgactgcgcgagggcggcgtctggggg
ctcatgccgcagctgtactcggtgcgctcgcgccggtcgtggggcgtcggtgacctcgcc
gacctcgccgagctcggctggctcgccgcccaccggtggaaggccgacttcctcctcgtc
aacccgctgcacgcggccgagccggtcgagccgctcacgcccagcccgtacctgcccacc
acgcggcgcttcgtcaacccgctgtacgtccgggtcgaggacgtgcccgagacggcctac
ctgtcggccgcagaccgcgccctcgtcgagtgggccgcggaacccgtcctgggtctcgcg
gcggaacccgggccgatcgaccgcgacgtcgcctgggccgccaagcgcgccgctctcgag
gtcgtgcacgcgcacccgctcgcgccggcgcggcaggcggccttcgacgcgtacgtcgag
gaggagggcgaggggctgcgcgagttcgcgctgtggtgcgcgctcgtcgagcggcacggc
ccgcccgcgggatggtccgacgagctgcacgacccgctgtccgacgcggtcgccgcggcc
gccgtcgagctggccgaccgggtcgcgttctggtcgtggctgcagtgggtggccgacgag
cagctcgagcacgcgcagcgcgtggcacgggacagcggcatggcgctggggatcatgcac
gacctcgccgtgggcgtgcaccccgagggcgccgacgcgtgggcgctgcgggacgtgctc
gcgacgggcgcctcggtcggcgccccgccggacatgtacaaccagcagggccaggactgg
tcgcagccgccgtggcacccggacgcgctcgcgcgcgcggcgtaccggccgtaccgcgac
atgctgcgcaccgtgctgcggcacgccggtgcgatccgcatcgaccacgtcatcgggctg
ttccggctgtggtgggtgccggtcggcaacggcgccaaggacggcgcgtacgtgcgctac
gaccacgaggcgctcgtcggcatcctcgcgctggaggcgcaccgcgccggcgccgtcgtc
atcggcgaggacctcggcaccgtcgagccgtgggtccgcgactacctggacgaccgaggg
atcctcggcacgtccgtgctgtggttcgagcaggagcacgacggccgcccccggcctccc
gagtcctaccggcaccgcgcgctcgcgaccgtcacgacgcacgacctgccgcccaccgcg
ggctacctggccggtgagcacgtcgcgctgcgcgacaggctgggcctgctcaccgagccg
gtcgccacggtccgcgcgcacgcagccgccgagcgtgagcgcatgctcgacgcgctgcgc
gagcgcggcctgctgggccacgacccgtcggagcgcgagatcgtcgaggcgctgcaccgc
tgggtccgtgccacgcccgccgtgctgctcggcgtctcgctcgccgacgcggtgggggag
cggcgcgcgcagaaccagccgggcacggaccaggagtacccgaactggaaggtgccgctc
gccgacggcaccgggcgtccggtgctgctcgacgacctgttcacgcacgcgcgtgcgcag
tcgctcgccgacgccatggggtcgtga

DBGET integrated database retrieval system