KEGG   Cellulomonas flavigena: Cfla_1413Help
Entry
Cfla_1413         CDS       T01230                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
cfl  Cellulomonas flavigena
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:cfl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566481..1567275
Genome map
AA seq 264 aa AA seqDB search
MSVGELRVWAPDGIREIVPGDDLVALLVAALRADAAADPGHALVDGDVVVVTSKVVSKAE
GRVVAADDRERAITEQTVRVVATREHAGGVTRIVENHLGLVMAAAGVDASNTPEGTVLLL
PADPDASARALRAGLTAAFGVRLGVLVTDTAGRPWRQGVTDLAIGAAGVDVLDDLRGQLD
TFGRPLTMTVAAVADEIASAAELVKGKASGRPVAVVRGVSHVVTDDDGPGARVLVRTGPD
DMFHQGSAEAYAQGWKDALERPER
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgggcgagctgcgcgtctgggcgcccgacggcatccgtgagatcgtcccgggc
gacgacctcgtcgcgctgctcgtcgccgcgctgcgcgccgacgcggccgcggacccgggt
catgcgctcgtggacggcgacgtcgtcgtggtcaccagcaaggtcgtctccaaggccgag
gggcgcgtggtcgcggccgacgaccgcgaacgggccatcaccgagcagaccgtgcgtgtc
gtcgcgacacgcgagcacgccggcggcgtgacgcggatcgtcgagaaccacctggggctg
gtcatggccgcggccggtgtcgatgcgtcgaacacccccgagggcacggtgctgctgctg
cccgcggaccccgacgcgtcggcgcgggcgctgcgcgccggtctcacggccgcgttcggt
gtccggctgggcgtgctggtcaccgacacggccgggcgcccgtggcggcagggtgtcacc
gacctggcgatcggcgcggccggcgtcgacgtgctcgacgacctgcgcggccagctcgac
acgttcggccgcccgctgacgatgaccgtggccgcggtggccgacgagatcgcgagcgcc
gccgagctggtcaagggcaaggcctcggggcgtcctgtcgcggtcgtccggggggtgagc
cacgtggtgaccgacgacgacgggccgggcgcgcgcgtgctggtgcgcaccggtcccgac
gacatgttccaccagggctccgccgaggcgtacgcgcaggggtggaaggacgcgctcgag
cgtccggagcggtga

DBGET integrated database retrieval system