KEGG   Cellulomonas flavigena: Cfla_1491Help
Entry
Cfla_1491         CDS       T01230                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00900  Terpenoid backbone biosynthesis
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01130  Biosynthesis of antibiotics
Module
cfl_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cfla_1491
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cfla_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: ADG74389
UniProt: D5UD52
Position
1652497..1653651
Genome map
AA seq 384 aa AA seqDB search
MSRSVVVLGSTGSIGTQALEIMGPRAGDFSVAGLSAGGAHVDLLVAQARAHAVPVVAVAD
TAAAAAVREALPGTRVLAGPDAAAELAASGADVVLNGITGSVGLLPTLAALRAGSTLALA
NKESLVVGGALVHAAAVRPDQIVPVDSEHSAIAQALRSGSEREVRRLVLTASGGPFRGWT
AEQVRTATPQQALAHPTWSMGPVVTVNSASLMNKGLELIEAHLLFGVPVERIAVVVHPQS
VVHSMVEFVDGSTIAQASPPDMRLPIALGLAWPDRVPGAASACDWTTATSWTFEPLDEDV
FPAVGLARRALAASATHPAVYNAANEECVDAFLSGRIGFGQVVDTVASVLDEHDGTPAGS
LTLDAVLAAERWARTRAHEVLATG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccggtcggtcgtcgtgctgggctccaccggctcgatcggcacccaggcgctcgag
atcatgggcccgcgcgcgggcgacttcagcgtggcgggcctctcggccggcggcgcccac
gtcgacctgctcgtggcgcaggcgcgtgcgcacgccgtgccggtcgtcgcggtggccgac
accgccgcggcagccgcggtccgcgaggcgctcccgggcacgcgagtgctggccgggccc
gacgcggcggccgagctcgccgcgtccggcgccgacgtcgtcctcaacgggatcacggga
tcggtcggcctgctgcccacgctcgcagcgttgcgcgccggcagcacgttggcgctcgcg
aacaaggagtccctcgtggtcggcggtgcgctcgtgcacgccgccgcggtccggcccgac
cagatcgtgccggtggactccgagcactcggccatcgcgcaggcgttgcgctcgggcagc
gagcgagaggtgcgccggctggtgctcacggcgtccggtggtccgttccgcgggtggacg
gccgagcaggtccgcaccgcgaccccgcagcaggccctcgcgcacccgacgtggtcgatg
ggcccggtcgtcacggtgaactcggcgagcctgatgaacaagggtctcgagctgatcgag
gcgcacctgctgttcggcgtcccggtggagcggatcgcggtggtggtgcacccccagtcc
gtcgtccattcgatggtcgagttcgtcgacggctcgacgatcgcgcaggcctcgccgccg
gacatgcggctgccgatcgcgctcggtctggcgtggcccgaccgcgtgcccggcgcagcg
tcggcgtgcgactggacgacggcgacgtcgtggacgttcgagccgctggacgaggacgtg
ttcccggcggtgggcctcgcacgccgggcgctcgcggcgtcggccacgcacccggcggtc
tacaacgccgcgaacgaggagtgcgtggacgcgttcctctcggggcgcatcggcttcggg
caggtcgtcgacacggtggcgtcggtgctggacgagcacgacgggacccctgccgggtcg
ctgaccctcgacgcggtgctcgcggccgagcggtgggcgcgcacgcgcgcgcacgaggtg
ctcgccaccggctga

DBGET integrated database retrieval system