KEGG   Cellulomonas flavigena: Cfla_1504Help
Entry
Cfla_1504         CDS       T01230                                 

Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cfl  Cellulomonas flavigena
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cfl03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1667006..1667896)
Genome map
AA seq 296 aa AA seqDB search
MPELPEVEALAQFLGERAVGRAVTRVEVAAISALKTFRPPPTALRGGTVLEASRHGKWLD
LSVGSLADGTLHVVWHLSRAGWVRWYDALPERPARPGKSPLALRVGFDDGSGFDLTEAGT
RKRLAVHVVADPADVPQIATLGVEPLSDAFTPERLGELLAARNQQVKGLLRDQGTIAGIG
NAYSDEILLVARTSPFAPTRSYDEARTRRLHTAIREVLTEAVTTAAGRPAAELKDAKRRG
MRVHGRTGEPCPGWDGTPCGDTVHEVSFADSSLQYCPTCQTGGKPLADRRMSRLLR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgccggagctgcccgaggtcgaggcgctcgcgcagttcctgggcgagcgggcggtcggc
cgtgccgtgacgcgcgtcgaggtcgcggcgatcagcgcgctcaagaccttccgtccccca
ccgaccgcgctgcgcgggggtaccgtgctcgaggcgtcccggcacggcaagtggctggac
ctctcggtcggctccctcgccgacggcacgctccacgtggtgtggcacctgtcgcgcgcc
gggtgggtgcgttggtacgacgcgctgccggagcgaccggcacgaccggggaagtccccg
ctcgctctgcgggtcgggttcgacgacggctccgggttcgacctcacggaggccggcacg
cgcaagcggctcgccgtgcacgtcgtcgcggacccggcggacgtcccgcagatcgccacc
ctcggcgtggagccgttgtccgacgcgttcacccctgagcgcctcggcgagctgctcgcg
gcacgcaaccagcaggtcaagggcctcctgcgtgaccagggcaccatcgcgggcatcggc
aacgcctactccgacgagatcctgctcgtcgcgcggacgagcccgttcgcacccacgcgc
tcgtacgacgaggcccgcacgcgcaggctgcacacggcgatccgcgaggtcctcaccgag
gccgtcaccaccgcggccggccgcccggccgcggagctcaaggacgccaagcgccgcggc
atgcgtgtgcacggacgcaccggggagccctgccccgggtgggacggcacgccgtgcggt
gacacggtgcacgaggtgtcgttcgcggactcctcgctgcagtactgcccgacgtgccag
accggcggcaagccgctcgcggaccgtcgcatgtcgcgcctgctgcgctga

DBGET integrated database retrieval system