KEGG   Cellulomonas flavigena: Cfla_1633Help
Entry
Cfla_1633         CDS       T01230                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00260  Glycine, serine and threonine metabolism
cfl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01130  Biosynthesis of antibiotics
cfl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cfla_1633
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cfla_1633
Enzymes [BR:cfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cfla_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADG74531
UniProt: D5UDX3
Position
complement(1818231..1819541)
Genome map
AA seq 436 aa AA seqDB search
MTTSPDTPRPAALTDPVGTVVPSAVPTHWYNLAADLPEPCPPALHPGTREPLTPEDLAPL
FPMALIGQEVSTERWVEIPQTVREIYALWRPSPLVRALRLERALGTPARIYYKYEGVSPA
GSHKPNTAVAQAYYNAVEGITRLTTETGAGQWGASLSMACSLLGLDLEVWQVRASYDAKP
YRRMQMETYGATCHPSPSDLTAAGRAMLAADPTTTGSLGMAISEAVEVAAQDPKAHYALG
SVLNHVLLHQSVIGQEALTQLDEIGETADVVFGCAGGGSNLGGLSFPFIGRNLRDGATTR
VVACEPAACPSMTQGEYRYDFGDVAGLTPLLKMHTLGKDFVPPPIHAGGLRYHGMAPMVS
HAYALGLMEAIAVEQEDAFAAGIEFARAEGIIPAPESTHAVAGAIAHARAATTDETIVIG
LSGNGVLDLPAYHDFV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcccccgacacgccccgacccgctgccctgaccgacccggtcggcaccgtg
gtgccctcggccgtgccgacccactggtacaacctcgccgccgacctgcccgagccgtgc
ccgcccgcgctgcaccccggcacgcgcgagcccctcaccccggaggacctcgcaccgctg
ttccccatggcgctcatcggccaggaggtctccaccgagcgctgggtcgagatcccgcag
accgtgcgggagatctacgcgctgtggcggccgtcaccgctcgtgcgggcgctgcgcctg
gagcgcgcgctcggcacccccgcgaggatctactacaagtacgagggcgtctcgcccgcc
gggtcgcacaagcccaacacggctgtggcccaggcctactacaacgccgtcgagggcatc
accaggctcacgaccgagacgggcgccggccagtggggtgcgtcgctgtcgatggcatgc
tcgctcctgggcctggacctcgaggtgtggcaggtccgtgcgtcgtacgacgccaagccg
taccgtcgcatgcagatggagacgtacggcgcgacgtgccacccgtcgccctcggacctc
accgcggcggggcgcgccatgctcgccgccgaccccaccaccacgggctccctggggatg
gcgatcagcgaggcggtcgaggtcgcggcacaggaccccaaggcgcactacgcgctcggg
tcggtgctcaaccacgtgctgctgcaccagagcgtgatcgggcaggaggcactcacgcag
ctcgacgagatcggcgagaccgcggacgtcgtgttcggctgcgccggcggcgggtcgaac
ctgggcgggctgtcgttcccgttcatcggccgcaacctgcgcgacggcgccacgacgcgc
gtcgtcgcgtgcgagccggcggcgtgcccgtcgatgacgcagggcgagtaccggtacgac
ttcggcgacgtcgcgggtctcacgccgctgctgaagatgcacacgctcggcaaggacttc
gtcccgccgcccatccacgcgggcggcctgcgctaccacggcatggcgccgatggtgtcg
cacgcctacgcgctggggctgatggaggcgatcgcggtcgagcaggaggacgcgttcgcc
gcgggcatcgagttcgcgcgcgccgaggggatcatcccggcgcccgagtcgacacacgcg
gtcgccggggcgatcgcgcacgcgcgcgccgccacgaccgacgagacgatcgtcatcggg
ctctcgggcaacggcgtgctcgacctgcccgcgtaccacgacttcgtctga

DBGET integrated database retrieval system