KEGG   Cellulomonas flavigena: Cfla_1775Help
Entry
Cfla_1775         CDS       T01230                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cfl  Cellulomonas flavigena
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cfl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1979035..1980144
Genome map
AA seq 369 aa AA seqDB search
MIDQTLAGCVVLVTADRRAAELRAALERRGATVRHAPALGMVPHTDDALLLARTRDLLAD
PPDTVVVTTGIGFRGWVEAADAAGIADRLLEVLATTRIVARGPKARGAIQAAGLSADWVA
ESETSAEIAEVLLDEGVAGRDVVIQHHGAGADGLDEAFAAAGARVRSLVVYRWGPPPDPD
LVRDSARAVADGEIDTVVFTSAPGAAAWVAAARDADALDGVLRRHTSGAVVFAAVGPVTA
KPLVDVGIDPLVPDRGRLGSLVRAVVTHYGGLEALDTVAGQLRVRRGAAVLDGRVLPLSR
TGLEVLRLLAHARGSVVPRDRVLDVLPGVSSDPHAAEVAIARLRDATGSRALIRTVVKRG
YRLELQEQA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccagacgctggccgggtgcgtcgtgctcgtcacggcggaccggcgggctgcc
gagctgcgcgctgcgctcgagcggcgtggcgcgacggtgcgtcacgcgcccgcgctcggg
atggtgccgcacaccgacgacgccctgctgctcgcccgcacgcgcgacctgctcgcggac
ccgccggacaccgtggtcgtcaccacgggcatcggcttccgcgggtgggtcgaggcagcc
gacgccgccgggatcgcggaccgtctgctcgaggtgctggccacgacccgcatcgtggcc
cgcggcccgaaggcgcgcggcgccatccaggccgccgggctgagcgccgactgggtggcg
gagtccgagacgagcgccgagatcgccgaggtgctgctcgacgagggcgtcgccggccgc
gacgtcgtcatccagcaccacggcgccggcgcggacggcctcgacgaggcgttcgccgcg
gccggggcgcgcgtgcgcagcctcgtcgtctaccggtggggtccgccgcccgacccggac
ctcgtccgcgactccgcccgcgcggtggccgacggcgagatcgacaccgtcgtgttcacg
tcggcgcccggcgccgcggcgtgggtcgcggcggcacgcgacgcggacgcgctcgacggc
gtgctgcgccgccacacgtccggggcggtggtgttcgcggccgtcggaccggtcaccgcc
aagccgctggtcgacgtcggcatcgacccgctcgtgccggaccgggggcggctcggctcg
ctcgtgcgcgccgtcgtgacgcactacggcggcctcgaggcactcgacaccgtcgcgggc
cagctgcgcgtgcgccgcggcgccgccgtcctcgacgggcgcgtgctgccgctgtcgcgc
accgggctcgaggtgctgcggctgctcgcgcacgcgcgcggctcggtcgtcccgcgtgac
cgcgtcctcgacgtgctgccgggggtatcgtccgacccgcacgcggccgaggtcgcgatc
gcgcggctgcgggacgccaccggcagccgtgcgctcatccgcacggtggtcaagcgcggc
taccggctcgagctccaggagcaggcatga

DBGET integrated database retrieval system