KEGG   Cellulomonas flavigena: Cfla_1795Help
Entry
Cfla_1795         CDS       T01230                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cfl  Cellulomonas flavigena
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cfla_1795
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cfla_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2000519..2001127
Genome map
AA seq 202 aa AA seqDB search
MIASVHGTVLAVRLDSAVLEVGGVGLLVQATPATLAGLRVGQPGRLSTSLVVREDALTLF
GFADDDERDVFETVQTVSGVGPRLALAMLAVHTPDGLRRAVAQEDIAALMRVPGIGRKGA
QRIVLELGERLGAPDPTGGTPAAPSADHREQVVEALVGLGWPLRAAQDAVASVLDGSAVP
VGAGEVPGVLRAALRTLGSARA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcgtcggtacacgggacggtgctggcggtacggctggactcggccgtcctcgag
gtcgggggagtgggtctgctggtgcaggcgacgccggcgacgctcgcggggctgcgggtc
gggcagccgggccggctgtcgacctcgctcgtcgtccgggaggacgccctcacgctcttc
ggcttcgccgacgacgacgagcgcgacgtgttcgagaccgtgcagacggtctcgggcgtc
ggtccgcgcctcgcgctggcgatgctcgccgtgcacacgccggacggcctgcgacgcgct
gtcgcacaggaggacatcgccgcgctgatgcgtgtgccgggcatcggacgcaagggcgcg
cagcgcatcgtgctcgagctcggcgagcggctcggcgcacccgacccgaccggcgggacc
cccgccgcaccgtcggcggaccaccgcgagcaggtggtcgaggcgctcgtcgggctcggg
tggccgctgcgcgccgcgcaggacgccgtggcctccgtcctcgacggatcggcggtgccc
gtcggcgccggggaggtccccggcgtgctgcgcgcggccctgcggaccctgggcagcgcg
cgtgcgtga

DBGET integrated database retrieval system