KEGG   Cellulomonas flavigena: Cfla_1850Help
Entry
Cfla_1850         CDS       T01230                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cfl  Cellulomonas flavigena
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Cfla_1850
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Cfla_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2063533..2064099
Genome map
AA seq 188 aa AA seqDB search
MTTTPARLTVLAGPTAVGKGTVSADIRARYPQVWLSVSMTTREPRPGEVDGLHYHFVSSE
RFDEMAERGELLEWAVVHGRNRYGTPRGPVLERLGSGEPALLEIDLQGARQVRESMPDAR
FVFLAPPSWEELVRRLVGRGTEGEEERERRLATARVELAAESEFDHVVVNDDVHRATDEI
VRLMGVDT
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgccggcacggctcaccgtgctcgccggaccgacagccgtgggcaagggg
acggtctcggccgacatccgtgctcgttacccgcaggtctggctgtcggtctccatgacg
acccgcgagccgcgcccgggtgaggtcgacggcctccactaccacttcgtctcgtccgag
cggttcgacgagatggccgagcgcggcgagctgctggagtgggctgtcgtgcacgggcgc
aaccggtacggcacgccccggggtccggtgctggagcggctgggctccggcgagccggcg
ctgttggagatcgacctgcagggcgcccggcaggtgcgcgagtcgatgcccgacgcacgc
ttcgtgttcctcgctccgccgtcctgggaggagctggtccgacggctcgtcggacggggg
accgagggcgaggaggagcgcgagcggcgcctggcgaccgctcgtgtcgagctcgcggcc
gagtcggagttcgaccacgtcgtcgtgaacgacgacgtgcaccgggcgacggacgagatc
gtccgtctgatgggcgtcgacacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system