KEGG   Cellulomonas flavigena: Cfla_1941Help
Entry
Cfla_1941         CDS       T01230                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_1941
   01230 Biosynthesis of amino acids
    Cfla_1941
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_1941
   00051 Fructose and mannose metabolism
    Cfla_1941
   00562 Inositol phosphate metabolism
    Cfla_1941
Enzymes [BR:cfl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cfla_1941
Exosome [BR:cfl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cfla_1941
  Exosomal proteins of bladder cancer cells
   Cfla_1941
  Exosomal proteins of melanoma cells
   Cfla_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2157996..2158790)
Genome map
AA seq 264 aa AA seqDB search
MANTRTPLMAGNWKMNLDHHQATHTVQKLAWTLKDAKHDYAAVEVAVLVPFTDLRSVQTL
VDADKLELVYGAQDVSAHESGAYTGEISPLFLAKLGVTYVAVGHSERRQYHAEDDAVVNA
KTTSALGAGLVPIVCVGEPLEVREAGEHVPHTLAQVEGALADLTAEQVAGLVIAYEPVWA
IGTGKTATPEDAQELCAAIRVKVAELYDQATADAVRVLYGGSVKSSNVASIMDKPDVDGA
LVGGASLDPEEFAKIARYQAHTVA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaacacgcgcaccccgctcatggcgggcaactggaagatgaacctcgaccaccac
caggcgacgcacaccgtgcagaagctcgcgtggacgctcaaggacgccaagcacgactac
gcagccgtcgaggtcgccgtgctcgtgccgttcaccgacctgcgcagcgtgcagacgctc
gtggacgcggacaagctcgagctggtctacggcgcccaggacgtgtcggcgcacgagtcc
ggcgcgtacaccggcgagatctcgccgctgttcctcgccaagctcggcgtcacgtacgtc
gccgtcgggcactccgagcgtcggcagtaccacgccgaggacgacgcggtcgtcaacgcc
aagacgacgtccgcgctcggtgcgggcctcgtgccgatcgtctgcgtcggtgagcctctc
gaggtccgcgaggccggcgagcacgtcccgcacacgctcgcgcaggtcgagggtgcgctg
gcggacctgacggccgagcaggtcgccggtctcgtcatcgcctacgagcccgtgtgggcg
atcggcaccggcaagaccgcgacgcccgaggacgcgcaggagctctgcgccgcgatccgc
gtcaaggtcgccgagctgtacgaccaggccaccgccgacgccgtgcgcgtgctctacggc
ggctcggtgaagtcgtcgaacgtcgcgtcgatcatggacaagccggacgtcgacggtgcc
ctcgtcggcggcgcgagcctcgaccccgaggagttcgcgaagatcgcgcgctaccaggcg
cacaccgtcgcctga

DBGET integrated database retrieval system