KEGG   Cellulomonas flavigena: Cfla_1961Help
Entry
Cfla_1961         CDS       T01230                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_1961
   01230 Biosynthesis of amino acids
    Cfla_1961
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_1961
   00030 Pentose phosphate pathway
    Cfla_1961
   00051 Fructose and mannose metabolism
    Cfla_1961
   00052 Galactose metabolism
    Cfla_1961
  Energy metabolism
   00680 Methane metabolism
    Cfla_1961
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cfla_1961
Protein phosphatases and associated proteins [BR:cfl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cfla_1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2181509..2182534)
Genome map
AA seq 341 aa AA seqDB search
MRVGLLTGGGDVPGLNAAIRAVVKRGEGEHGHSIIGFRNGWKGVVDGDVMPLSRRDIRNV
LPTGGTLLGTARYHPHASDGGLEAALATLEAERIEALICIGGDGTLNAASKVAEAGVKVV
GIPKTIDNDVWATDASIGFDTAVSIATEAIDRIHTTAESHNRVMIVEVMGRHAGWIAVTS
GIAGGAELVLAPEEPFDITRIEKFLKHRHRAHASFSIVVVAEGAVPAEGTSMHYETQVGK
FGEIVAGAIGERLKVEIEQRTGFDTRVTVLGHTQRGGIPTAADRILASRFGVAAIDAVTA
GTTNVMTAIRGEEVVLVPLSQVAGKVKYVPQDLLTVARALA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgagtcggtctgctgaccggtggcggtgacgtccccggcctgaacgccgcgatccgt
gcggtcgtcaagcggggggagggcgagcacggacactcgatcatcggcttccgcaacggg
tggaagggcgtcgtcgacggcgacgtcatgccgctgtcgcgccgcgacatccgcaacgtg
ctgccgaccggtggcacgctgctgggcacggcgcggtaccacccccacgcgtcggacggc
ggcctggaggccgcgctggccacgctcgaggccgaacgcatcgaggcgctgatctgcatc
ggcggcgacggcacgctgaacgccgcgagcaaggtggccgaggcgggcgtgaaggtcgtc
ggcatccccaagaccatcgacaacgacgtgtgggcgaccgacgcgtccatcggcttcgac
accgcggtgagcatcgccaccgaggcgatcgaccggatccacacgaccgccgagtcgcac
aaccgcgtgatgatcgtcgaggtcatgggccggcacgcggggtggatcgccgtcacgtcg
ggcatcgcaggcggcgccgagctcgtgctcgcccccgaggagccgttcgacatcacgcgg
atcgagaagttcctcaagcaccgccaccgtgcgcacgcgagcttctcgatcgtcgtcgtc
gccgagggcgcggtgccggccgagggcacctcgatgcactacgagacgcaggtcggcaag
ttcggcgagatcgtcgccggcgcgatcggcgagcggctcaaggtcgagatcgagcagcgc
acgggcttcgacacgcgcgtcaccgtgctggggcacacgcagcgcggcggcatcccgacc
gcggccgaccgcatcctcgcctcgcgcttcggggtcgcagcgatcgacgcggtgacggcc
ggcacgaccaacgtcatgacggcgatccgcggcgaggaggtcgtgctcgtgccgctgtcg
caggtggcgggcaaggtcaagtacgtgccgcaggacctgctgaccgtggcgcgcgcgctg
gcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system