KEGG   Cellulomonas flavigena: Cfla_1984Help
Entry
Cfla_1984         CDS       T01230                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cfla_1984
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cfla_1984
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cfla_1984
Enzymes [BR:cfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cfla_1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2212291..2213127)
Genome map
AA seq 278 aa AA seqDB search
MSVTDVRSATGERLDELAAGPAPRAALVGYLPVGFPTVPGSARAVRTMVDAGVDVVELGI
PYTDPVMDGPVIQAAANRALAQGTRVADTLRVAEQVAGAGAPVLVMTYWNIVLRYGVDAF
ARDLAAAGGAGLITPDLIPDEGAEWLAASDAHGLDRVFLVAPSSTPERLASTVAASRGFV
YAASTMGVTGERTTVGDRAEQLVAATRAAGAARVCVGLGVSRPEQAAEVAGYADGVIVGS
ALVRALLEAPDEASGLTALEGVVRGLADGVRGAVRAPR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtgacggacgtgcggtcggcgacgggggagcggctcgatgagctcgccgccggg
cccgccccccgggcggcgctcgtcggctacctgcccgtcggcttcccgacggtgccgggg
tcggcacgcgcggtgcgcaccatggtcgacgccggcgtcgacgtcgtcgagctcggcatc
ccgtacaccgatcccgtcatggacgggccggtcatccaggccgcggcgaaccgcgcgctc
gcacagggcacgcgcgtggccgacacgctgcgcgtcgcggagcaggtcgccggcgccggt
gcgcccgtgctggtgatgacctactggaacatcgtcctgcggtacggcgtcgacgcgttc
gcccgggatctcgcggccgcgggcggcgcaggcctcatcacccccgacctcatccccgac
gagggtgcggagtggctcgccgccagcgacgcgcacggcctggaccgggtgttcctcgtc
gccccgagctccacgccggagcggctcgcctccacggtggcggccagccgcgggttcgtc
tacgcggcctcgacgatgggcgtcacgggtgagcgcacgacggtgggggaccgcgcggag
cagctcgtggccgcgacccgggctgccggggcggcacgcgtgtgcgtcggcctcggcgtc
tcgcggcccgagcaggctgccgaggtcgcgggctacgccgacggcgtgatcgtgggctcg
gcgctcgtgcgcgccctgctggaggcaccggacgaggcgtcgggcctcaccgcgctcgag
ggggtcgtccgcgggctcgcggacggggtgcggggggcggtccgggcgccgcgatga

DBGET integrated database retrieval system