KEGG   Cellulomonas flavigena: Cfla_1985Help
Entry
Cfla_1985         CDS       T01230                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cfla_1985
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cfla_1985
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cfla_1985
Enzymes [BR:cfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cfla_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2213124..2214392)
Genome map
AA seq 422 aa AA seqDB search
MLAGGGPLARHEGPYFGDFGGRFVPEALIAALDELETYYRKALADPSFADELERLHRTYT
GRPSPITEVPRFARHVGDGVRVFLKREDLNHTGSHKINNVLGQALLVRRMGKRRVIAETG
AGQHGVATATAAALLDLECTIYMGEEDTRRQALNVARMELLGATVVPVTVGARTLKDAIN
EALRDWVANVETTHYLLGTVTGPHPFPEMVRDFHKVIGEEARAQVLEETGHLPEAVVACV
GGGSNAMGIFNAFLDDPQVRLFGFEAGGEGISSGRHSARFSGGAPGVLHGARSYLLQDED
GQTLPSHSVSAGLDYPSVGPEHAWLHDTGRAQYRPVTDDEAMEAFRLLCRTEGIIPAIES
AHALAGAIQLGREAQGWGQDGRPPVLLVNLSGRGDKDVATAAAWFGLLEPEPVVKADEGE
QL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcgggcggcgggccgctcgcccgccacgagggcccgtacttcggggacttcggg
ggccggttcgtgcccgaggcgctcatcgccgcgctcgacgagctcgagacgtactaccgc
aaggcgctcgccgacccgtcgttcgccgacgagctcgagcgtctgcaccgtacctacacc
gggcgtcccagcccgatcacggaggtgccgcggttcgcgcggcacgtcggcgacggggtg
cgggtcttcctcaagcgcgaggacctcaaccacaccgggtcgcacaagatcaacaacgtc
ctcgggcaggcgctgctcgtcaggcgcatgggcaagcgtcgcgtcatcgcggagacgggt
gcggggcagcacggtgtcgccaccgcgacggccgcggcgctgctcgacctcgagtgcacg
atctacatgggcgaggaggacacgcgccgtcaggcgctgaacgtcgcgcgcatggagctg
ctcggcgcgaccgtcgtgcccgtcaccgtcggcgcccgtacgctcaaggacgcgatcaac
gaggcgctgcgcgactgggtcgccaacgtcgagacgacgcactacctcctgggaaccgtc
accggcccgcacccgttccccgagatggtgcgggacttccacaaggtgatcggcgaggag
gcgcgcgcgcaggtcctcgaggagaccggtcacctgcccgaggcggtcgtggcgtgcgtc
ggcggcgggtcgaacgcgatgggcatcttcaacgcgttcctcgacgacccgcaggtccgg
ctcttcggcttcgaggccggcggcgagggcatctcctcgggccggcactcggcgcgcttc
tccggcggcgcgcccggcgtgctgcacggcgcgcgcagctacctgctgcaggacgaggac
gggcagacgctgccgagccactcggtctctgccggcctggactacccgagcgtcgggccg
gagcacgcgtggctgcacgacaccggacgcgcgcagtaccggcccgtcacggacgacgag
gccatggaggcattccggctgctgtgccgcaccgagggcatcatcccggcgatcgagtcc
gcgcacgccctcgccggggcgatccagctgggccgggaggcccaggggtggggtcaggac
ggccgcccgccggtgctcctggtcaacctgtcgggccgcggggacaaggacgtggcgacg
gcggcggcgtggttcggtctgctcgagcccgagcccgtggtgaaggcggacgagggagag
cagctgtga

DBGET integrated database retrieval system