KEGG   Cellulomonas flavigena: Cfla_2024Help
Entry
Cfla_2024         CDS       T01230                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cfl  Cellulomonas flavigena
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2252741..2255011)
Genome map
AA seq 756 aa AA seqDB search
MRRTIGRAALVAAVSLGALVGAAALTPAAAAPSGSGPNPADYSTTGALPNHTIYKPVNLP
SQRMPIVVWSNGACSADGTSAQNFLKEIASWGFLVVSNGRPNGSGSSNSTWLTQAMDWAV
AQNSNSSSDLYNRLDTSKIGVAGFSCGGIEAYAVSGDPRVTTTGIFSSGLLNDADDYQLR
RLDHPIAYIIGGQSDIAYPNAMDDWGKLPQGLPAFMGNLNVGHGGTYHETNGGAFGFAAQ
QWFRWQLKGDTTAAQTFVGQNCGLCRNGWQVQQKNLTVTQPTQSPTPSPTPSPTQSTPPV
QTPTPTPTQTIPSSQPGATLQAAAARTGRYFGVALAAGKLNDSTYTTIANREFNMVTAEN
EMKMDATEPNQNQFNFSQGDRILNWATQNGKQVRGHALAWHSQQPGWMQNMSGTQLRNAM
LNHVTRVATYYKGKIHSWDVVNEAFADGNGGARRDSNLQRTGDDWIEAAFRAARAADPGA
KLCYNDYNTDNWTWDKTQAVYRMVRDFKSRGVPIDCVGFQSHFNAQSAYNSNYRTTLSSF
AALGVEVQITELDIEGSGQQQAQTYANVVNDCLAVPACKGITVWGVRDSDSWRSYGTPLL
FDNSGNKKEAYTATLNALNAAAPVPTQEPTQTPTQEPTQTQEPTQTPTVTPTQDPGQGSG
ACTATYTVANQWGEGFVADVTVTANQDLTGWKVSIQLPGGAGVSQTWNGTRGSASTGLVT
VANAGWNGRVAAGQSTSFGFQGTGNGAGATVSCEAA
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcaccatcggacgggcggcgctggtcgccgcggtgtcgctcggcgcactggtc
ggtgccgccgctctgacgcctgcggccgcagcgccgagcgggtcgggcccgaaccccgcc
gactactccaccaccggcgccctgcccaaccacacgatctacaagccggtgaaccttccg
tcgcagcgcatgcccatcgtggtgtggtccaacggtgcgtgctcggcggacggcacgtcg
gcgcagaacttcctcaaggagatcgcctcctggggcttcctcgtcgtctccaacggccgc
cccaacggaagtggcagctcgaactccacgtggctgacgcaggccatggactgggccgtg
gcccagaactcgaacagcagcagcgacctgtacaacaggctcgacaccagcaagatcggt
gtcgccggcttctcgtgcggcggcatcgaggcctacgcggtctccggtgacccgcgcgtc
acgacgaccggcatcttcagcagcggtctgctgaacgacgcggacgactaccagctgcgc
cgtctcgaccacccgatcgcctacatcatcggtggccagagcgacatcgcgtaccccaac
gcgatggacgactggggcaagctgccgcagggcctgcccgccttcatgggcaacctcaac
gtcggtcacggcggtacgtaccacgagaccaacggcggggccttcggcttcgcggcccag
cagtggttccggtggcagctcaagggcgacacgacggcggcgcagacgttcgtcggtcag
aactgcggcctgtgccgcaacggctggcaggttcagcagaagaacctcacggtgacccag
ccgacgcagtcgccgacgccgtcgccgaccccctcgccgacgcagagcaccccgccggtc
cagacgcccaccccgacgccgacgcagacgatcccgtcgtcccagcccggcgcgacgctg
caggccgcggcggcccgcacgggccggtacttcggtgtggccctggcggcgggcaagctc
aacgactcgacctacacgaccatcgcgaaccgtgagttcaacatggtgacggccgagaac
gagatgaagatggacgccacggagccgaaccagaaccagttcaacttctcccagggcgac
cggatcctgaactgggcgacgcagaacggcaagcaggtgcgtgggcacgcgctggcgtgg
cactcccagcagccgggctggatgcagaacatgtccggcacgcagctgcgcaacgcgatg
ctcaaccacgtcacgcgggtcgcgacgtactacaagggcaagatccacagctgggacgtg
gtgaacgaggcgttcgccgacggcaacggcggtgcgcgtcgtgactcgaacctgcagcgc
accggtgacgactggatcgaggccgcgttccgcgccgcgcgcgccgcggacccgggcgcc
aagctctgctacaacgactacaacaccgacaactggacgtgggacaagacccaggccgtc
taccgcatggtccgtgacttcaagtcgcgcggcgtgccgatcgactgcgtgggtttccag
tcgcacttcaacgcccagtcggcgtacaacagcaactaccgcacgacgctgtcgagcttc
gccgccctgggtgtcgaggtgcagatcaccgagctggacatcgagggctcgggtcagcag
caggcgcagacgtacgcgaacgtcgtgaacgactgcctcgccgtgccggcctgcaagggc
atcacggtctggggtgtgcgtgactccgactcgtggcgctcgtacggcaccccgctgctg
ttcgacaactcgggcaacaagaaggaggcctacacggccaccctcaacgccctgaacgcc
gcggcgccggtcccgacgcaggagccgacgcagacgccgacgcaggagccgacgcagacg
caggagccgacgcagacgccgacggtcaccccgacgcaggacccgggccagggctcgggt
gcgtgcaccgcgacctacacggtcgcgaaccagtggggtgagggcttcgtcgccgacgtc
acggtcacggccaaccaggacctcaccggatggaaggtgagcatccagctccccggcggt
gccggggtctcgcagacctggaacgggacgcgagggagcgccagcaccggcctcgtcact
gtggcgaacgccggctggaacggtcgtgtcgcagctggtcagagcaccagcttcggcttc
caggggaccggcaacggggcgggcgcgaccgtctcgtgcgaggccgcctga

DBGET integrated database retrieval system