KEGG   Cellulomonas flavigena: Cfla_2069Help
Entry
Cfla_2069         CDS       T01230                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_2069
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_2069
   00052 Galactose metabolism
    Cfla_2069
   00500 Starch and sucrose metabolism
    Cfla_2069
   00520 Amino sugar and nucleotide sugar metabolism
    Cfla_2069
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cfla_2069
   00524 Butirosin and neomycin biosynthesis
    Cfla_2069
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cfla_2069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2310836..2311783)
Genome map
AA seq 315 aa AA seqDB search
MHAIGVDIGGTKIAAGVVDDDGTILAQTRRDTDPDDAASIDAAIADVYRELSASYEVRQV
GLAAAGFVASDRARVLFAPNIAWREYPLRDNVAALIGDEDLRIVVENDANAAGWAEFRFG
VGRDVQDMVMLTLGTGLGGAIVVDGRLTRGAWGVAAEIGHMRVVPGGHYCGCGHEGCWEQ
YVSGSALVRDARAAAMTQPERAAGLVALAGGSAQHIDGPLVTRAAQAGDALAVELLAEVG
RWVGEGCASVSAVLDPEVFVIGGGVSAAGDLVVAPARKAFDAQLSGRGHRPEAGIVVAAM
GNDAGMVGAADLARV
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcacgccatcggggtcgacatcggcgggacgaagatcgcggcgggcgtcgtcgacgac
gacgggacgatcctcgcgcagacccggcgggacaccgaccccgacgacgcggccagcatc
gacgcggcgatcgccgacgtgtaccgggagctcagcgcgtcctacgaggtgcgacaggtc
gggcttgccgcggccgggttcgtggcctccgaccgggcgcgtgtgctgttcgcccccaac
atcgcgtggcgcgagtacccgctgcgcgacaacgtcgcggcgctgatcggcgacgaggac
ctgcggatcgtcgtcgagaacgacgccaacgcggccggctgggccgagttccggttcggc
gtgggacgagacgtgcaggacatggtgatgctcacgctcggcacgggactgggcggggcg
atcgtcgtcgacggccgcctcacgcgcggtgcctggggtgtcgcggccgagatcggtcac
atgcgggtcgtgcccggcgggcactactgcggctgcggccacgagggctgctgggagcag
tacgtgtcgggttcggcgctcgtgcgcgacgcgcgggcggccgcgatgacgcagccggag
cgtgccgccgggctggtcgcgctcgctggcggcagcgcccagcacatcgacgggccgctg
gtcacgcgcgccgcgcaggccggcgacgccctggccgtcgagctgctcgccgaggtcggt
cgctgggtgggcgagggctgcgcgtccgtgtcggcggtgctcgaccccgaggtcttcgtc
atcgggggcggcgtgagcgcggccggcgacctggtggtggcacccgcgcgcaaggcgttc
gacgcgcagctctcgggtcgcgggcaccgcccggaggccggcatcgtcgtggctgcgatg
ggcaacgacgcgggcatggtcggcgcggccgacctcgcgcgcgtctga

DBGET integrated database retrieval system