KEGG   Cellulomonas flavigena: Cfla_2101Help
Entry
Cfla_2101         CDS       T01230                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cfl  Cellulomonas flavigena
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_2101
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cfla_2101
  Amino acid metabolism
   00310 Lysine degradation
    Cfla_2101
Enzymes [BR:cfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Cfla_2101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2342744..2344555
Genome map
AA seq 603 aa AA seqDB search
MSQNVQLPALGESVTEGTVTRWLKNVGDTVEVDEPLLEISTDKVDTEIPSPVAGVLEQIL
VQEDETVEVGATLAVIGSGEGGGDAGSGEQQAPAEEPVAEQAPAEEPAAEQSAQQPVEEH
EDAPGPAPSTGGGGSGQEVTLPALGESVTEGTVTRWLKAVGDEVAVDEPLLEISTDKVDT
EIPSPVAGTLQEIRVQEDETVEVGAVLAVVGSGDAAPAAEQPAAPQQPEEQASEPAAETP
QGAAQEPAGYEAPAPEAEAAPAAEQQAPAAQEAAAAQPTATQTPAPSAPAPSAGGSYLTP
LVRKLAAEKGVDVSTLTGSGVGGRIRKEDVLEAAAKAEEARKAAAAPAAPAAAPAKAAAP
APVSPLRGTTEKASRLRQIIAERMVEALHTQAQLTTVVEVDVTRIAKLRARAKADFAARE
GVNLTYLPFFVQAAIEGLKTYPKINGVLEGTQITYHGQENVAIAVDTERGLLTPVIRDAG
DLNLAGIARKIADLASRTRANKVTPDELSGATFTVTNTGSGGAIIDTPIVPGGTSAILGT
GAIVKRPVVVKGPDGDEVIAIRSMCYLCLSYDHRLVDGADASRYLTAVKNRLEEGAFEAE
LGL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaacgtgcagcttcccgcgctcggcgagtccgtcaccgagggcaccgtcacc
cgctggctcaagaacgtcggtgacaccgtcgaggtcgacgagcccctgctcgagatctcg
accgacaaggtcgacaccgagatcccctcgccggtggccggcgtgctcgagcagatcctc
gtccaggaggacgagacggtcgaggtcggcgccacgctcgccgtcatcggctcgggcgag
ggcggcggtgacgccggctcgggcgagcagcaggcacccgccgaggagcccgtcgccgag
caggcacccgccgaggagcccgcggcggagcagtccgcgcagcagcccgtcgaggagcac
gaggacgccccgggacccgcgccgtccacaggtggcggtggcagtggccaggaggtcact
ctcccggcgctcggcgagtccgtcaccgagggcacggtcacgcgctggctcaaggccgtg
ggcgacgaggtcgcggtcgacgagccgctgctggagatctccaccgacaaggtggacacg
gagatcccgtcgcccgtcgcgggcacgctgcaggagatccgcgtccaggaggacgagacc
gtcgaggtcggcgccgtgctggccgtcgtcggatcgggcgacgcggctcccgccgccgag
cagcccgccgcaccgcagcagcccgaggagcaggcgagcgagcccgccgccgagaccccg
cagggcgcggcgcaggagcccgccggctacgaggcgcccgcgcccgaggccgaggcggcg
cccgccgccgagcagcaggctcccgccgcgcaggaggccgccgccgcgcagccgaccgcc
acgcagacgccggcaccgtccgcgcccgcgccgtccgccggtggctcgtacctcacgccg
ctcgtgcgcaagctcgcggccgagaagggcgtcgacgtgtcgaccctcacgggctcgggc
gtcggtgggcgcatccgcaaggaggacgtgctcgaggccgcggccaaggccgaggaggcc
cgcaaggccgccgcggcgccggccgccccggccgcggctcccgcgaaggccgccgccccg
gcgccggtctcgccgctgcgcggcacgaccgagaaggccagccgactgcggcagatcatc
gccgagcgcatggtcgaggcgctgcacacgcaggcgcagctcaccacggtggtcgaggtc
gacgtcacgaggatcgccaagctgcgtgcccgcgccaaggcggacttcgcggcacgcgag
ggcgtcaacctcacgtacctgccgttcttcgtccaggccgcgatcgaggggctcaagacc
tacccgaagatcaacggcgtgctcgagggcacccagatcacgtaccacgggcaggagaac
gtggcgatcgcggtcgacaccgagcgcggcctgctgacgccggtcatccgcgacgccggc
gacctcaacctcgcgggcatcgcgcgcaagatcgccgacctcgcctcgcgcacgcgtgcc
aacaaggtgacgccggacgagctgtcgggcgccacgttcaccgtgacgaacaccggctcg
ggcggcgcgatcatcgacaccccgatcgtgcctggtggcacgtcggcgatcctcggcacc
ggggcgatcgtcaagcgcccggtcgtcgtcaaggggcccgacggcgacgaggtcatcgcc
atccggtcgatgtgctacctgtgcctgtcgtacgaccaccggctcgtcgacggcgccgac
gcgtcgcgctacctcaccgcggtcaagaaccgcctcgaggagggcgcgttcgaggccgag
ctcggcctctga

DBGET integrated database retrieval system