KEGG   Cellulomonas flavigena: Cfla_2351Help
Entry
Cfla_2351         CDS       T01230                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00521  Streptomycin biosynthesis
cfl00523  Polyketide sugar unit biosynthesis
cfl01130  Biosynthesis of antibiotics
Module
cfl_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Cfla_2351
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cfla_2351
Enzymes [BR:cfl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Cfla_2351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADG75241
UniProt: D5UHC0
Position
2626347..2626979
Genome map
AA seq 210 aa AA seqDB search
MHYRELSVPGAWEITPKQHGDPRGVFLEYFKGGPFAEATGHAFDLQQANCSVSAAGVLRG
IHFADVPPGQAKYVTCAKGAVLDVVVDIRVGSPTFGRWDTVLLDDTDRRAIYLGEGLGHA
FMSLEDDSTVLYLCSTGYAPGREHGIHPLDPEIGITWPTTARDGSPLTPQLSEKDTAAPT
LAEARAAGLLPDAAVVEEYVQGLRDRARGA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
gtgcactaccgcgagctgagcgtccccggggcgtgggagatcacgccgaagcagcacggc
gacccccgcggggtgttcctcgagtacttcaagggcggcccgttcgccgaggccacgggg
cacgcgttcgacctgcagcaggcgaactgctcggtgtcggccgccggcgtgctgcgtggc
atccacttcgccgacgtccccccggggcaggccaagtacgtgacgtgcgccaagggcgcg
gtgctcgacgtcgtcgtcgacatccgcgtgggctcgccgacgttcgggcggtgggacacc
gtgctgctcgacgacaccgaccgccgcgcgatctacctcggcgagggcctggggcacgcg
ttcatgtccctcgaggacgactcgacggtgctctacctctgctcgacggggtacgcgccg
ggccgcgagcacggcatccacccgctcgaccccgagatcggcatcacctggcccacgacg
gcccgcgacggcagccccctgacgccgcagctgtccgagaaggacacggccgcacccacg
ctggccgaggcgcgcgccgccggcctgctgccggacgcggccgtcgtcgaggagtacgtg
cagggcctgcgcgaccgggcgcgcggcgcctga

DBGET integrated database retrieval system