KEGG   Cellulomonas flavigena: Cfla_2430Help
Entry
Cfla_2430         CDS       T01230                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cfl  Cellulomonas flavigena
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cfla_2430
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Cfla_2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2725946..2727889
Genome map
AA seq 647 aa AA seqDB search
MSEVTQPRAAAAAPGPDTGDPRRPWRAGPLLTTFADAGVLTSADVRVAERLGDLTGEDDP
TVHLAAALAVRAVRAGSVCVDLADAPSLVAEGSPDDPDAPLPAGTLPWPDTAAWTAAVRG
SGMVADGVDGPADRPVRWVDGRVYLDRYWRDEQVVRRDVDARLTSLLDVDDDALRRAVHA
RFPRAQDARQRVAAATAAVSRLTVLTGGPGTGKTTTVARLVAVLRDVAGPGLRIALAAPT
GKAATRLQEAVNAELARLDDAAVGGTVAAPGAARPLTASTIHRLLGWRPSSTRFAHDHAH
RLPHDVVVLDEASMVSLPLLARVLDALRPDARLVLVGDPDQLASVEVGAVLGDLVARPTR
SGPLPARLAALLPDDVPGTATSADDTRDAAALHGGVVRLVVTHRFGHELAELADAVRRGD
ADATLALLRAGGAHASLVEPAAEVPTEDEVPGLRGDVSATGARLVAAARAGDTAGALEAL
GVHRLLLAHRRGPAGVARWAALAQRWVEKTVGDLQPGPLSLGRPLLVTVNDRTTGLSNGD
IGVLVSDGAGGVVAAFGESHAPRLVRPHRLPAVETVHAMTVHRAQGSQFTFVTVLLPPAS
SPLLTRELLYTAVTRAQEHVRVVGSAEAVRRAVERPVRRASGLRFAR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaggtgacgcagccgcgcgctgccgccgcggcgccggggccggacaccggcgac
ccgcgccgcccgtggcgcgcgggtccgctgctgacgacgttcgccgacgccggggtgctg
acgtccgccgacgtgcgcgtcgcggagcgcctgggcgacctcacgggcgaggacgacccg
acggtccacctggcggccgcgctcgccgtacgggcggtgcgcgccggctcggtgtgcgtc
gacctggccgacgcaccgtccctggtcgccgagggctcccccgacgaccccgacgcgccc
ctgccggccggcacgctgccctggcccgacacggccgcgtggacggccgccgtgcgcggc
agcggcatggtcgccgacggtgtcgacggcccggccgaccggccggtgcggtgggtcgac
gggcgcgtgtacctcgaccggtactggcgcgacgagcaggtcgtgcggcgcgacgtcgac
gcgcgcctgacgtcgctgctcgacgtcgacgacgacgcgctgcgccgggccgtgcacgcg
cggttccctcgtgcgcaggacgcgcggcagcgcgtggccgccgcgacggccgcggtgtcg
cgcctcacggtgctcaccggcggcccgggcaccggcaagacgacgaccgtggcgcggctc
gtcgccgtgctgcgcgatgtggccgggccgggcctgcggatcgcgctggccgcgccgacc
ggcaaggccgcgacccggctgcaggaggcggtgaacgccgagctcgcccggctcgacgac
gccgccgtgggcgggaccgtggcggctccgggcgcggcccggccgctgaccgcctcgacg
atccaccgtctgctggggtggcgcccgtcgagcacgcggttcgcacacgaccacgcacac
cggctcccccacgacgtcgtggtgctcgacgaggcgtcaatggtgtccctgccgctgctg
gcgcgcgtgctggacgcgctgcgcccggacgcgcggctcgtgctcgtcggcgacccggac
cagctcgcgtccgtcgaggtcggggcggtgctcggcgacctcgtcgctcgccccacgcgg
tccggtccgctgcccgcacgcctcgcggcgctgctgccggacgacgtgccggggactgcg
acgagcgccgacgacacccgcgacgccgcggccctgcacggcggcgtcgtgcgcctggtc
gtcacgcaccggttcgggcacgagctcgcggagctcgccgacgcggtgcgccgaggtgac
gcggacgcgacgctcgcgctgctgcgggccggcggggcgcacgcgtcgctggtcgagccc
gcggccgaggtgccgacggaggacgaggtgcccgggctgcggggggacgtcagcgcgacg
ggcgcgcgtctcgtcgccgcggcccgcgcgggcgacacggcaggagcgctggaggcgctc
ggggtgcaccgcctgctgctcgcgcaccgccgcgggccggccggggtcgcacgctgggcg
gcgctcgcgcagcgctgggtcgagaagacggtcggcgacctgcagccggggcctctctcg
ctcggtcgccccctgctcgtcaccgtcaacgaccgcacgaccgggctgtcgaacggcgac
atcggcgtcctggtctccgacggtgccggtggggtggtcgcggcgttcggggagtcgcac
gccccgcgcctcgtgcgcccgcaccggctgcctgccgtggagacggtgcacgcgatgacg
gtgcaccgcgcgcagggcagccagttcacgttcgtcaccgtgctgctgccgcccgcgtcg
tcgccgctgctcacgcgcgagctgctgtacaccgcggtcacccgcgcgcaggagcacgtg
cgcgtcgtcgggtccgcggaggccgtccgccgggccgtcgagcgtccggttcgccgtgcg
agcggcctgcgcttcgcgcgctga

DBGET integrated database retrieval system