KEGG   Cellulomonas flavigena: Cfla_2537Help
Entry
Cfla_2537         CDS       T01230                                 

Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cfl  Cellulomonas flavigena
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_2537
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cfla_2537
   00640 Propanoate metabolism
    Cfla_2537
   00660 C5-Branched dibasic acid metabolism
    Cfla_2537
Enzymes [BR:cfl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Cfla_2537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2846690..2847871)
Genome map
AA seq 393 aa AA seqDB search
MDLFEYQARDIFEKHGVPVLGGIVATTPEEARAAAEQLLPAEGGVVVVKAQVKTGGRGKA
GGVKIARSADEAAERAGEILGMDIKGHTVHRVMIAAGARIAQEFYFSLLLDRAERRYLAM
CSVEGGMEIEQLAVERPEALAKVAVDPRTGIDQAKADEIVAAAGFAPEIAGEVAAVLQKL
WLVYRDEDATLVEVNPLVLTEEGDVVALDGKVTLDANADFRHEDHAALEDKAAADPLEAR
AKEKDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEAHGGVKPANFLDIGGGASAEVMA
AGLDIILTNPQVKSVFVNVFGGITACDAVANGIVAALEILGDEASKPLVVRLDGNNVVEG
RRILAAAGHPLVTLADTMDGGADEAARLAHAAA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcacgtgacatcttcgagaagcacggcgtgcccgtgctc
ggcggcatcgtcgccacgacgcccgaggaggcgcgcgcagctgccgagcagctgctcccc
gccgagggcggcgtcgtcgtcgtgaaggcgcaggtgaagacgggtggccgcggcaaggcg
ggcggcgtcaagatcgcccgctccgccgacgaggcggccgagagggccggagagatcctc
gggatggacatcaaggggcacaccgtccaccgcgtgatgatcgcggccggcgcgcggatc
gcccaggagttctacttctccctgctgctggaccgcgccgagcgtcgctacctggcgatg
tgctcggtcgagggcggcatggagatcgagcagctcgcggtcgagcgcccggaggcgctc
gccaaggtcgcggtcgacccgcgcacgggcatcgaccaggcgaaggccgacgagatcgtc
gccgccgcgggcttcgcgcccgagatcgccggcgaggtcgccgctgtcctgcagaagctg
tggctcgtctaccgggacgaggacgcgacgctcgtcgaggtcaacccgctcgtgctcacc
gaggagggcgacgtcgtcgcgctcgacggcaaggtgacgctcgacgcgaacgccgacttc
cgccacgaggaccacgcggccctggaggacaaggcagcggccgacccgctcgaggcgcgc
gccaaggagaaggacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaac
ggcgcgggcctcgtcatgagcacgctcgacgtcgtcgcgtacgccggtgaggcgcacggc
ggcgtgaagcccgccaacttcctcgacatcggcggcggcgcgtcggccgaggtcatggcc
gcgggtctcgacatcatcctcacgaacccgcaggtcaagtccgtgttcgtcaacgtcttc
ggcggcatcacggcgtgcgacgccgtcgccaacggcatcgtcgcggcgctcgagatcctc
ggcgacgaggcgtccaagccgctcgtcgtgcgcctggacggcaacaacgtcgtcgagggc
cgccggatcctcgcggctgccggccacccgctggtgacgctcgccgacacgatggacggc
ggcgccgacgaggccgcccgcctggcgcacgccgccgcctga

DBGET integrated database retrieval system