KEGG   Cellulomonas flavigena: Cfla_2576Help
Entry
Cfla_2576         CDS       T01230                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
cfl  Cellulomonas flavigena
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cfla_2576
Enzymes [BR:cfl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Cfla_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2884761..2887307
Genome map
AA seq 848 aa AA seqDB search
MTSTTSDPQRTGAGPIAPGQFAAAEARTAWRRGTGEVDDATLQRIEKFWRAANYLSVGQI
YLLDNPLLRRPLSRDDVKPRLLGHWGTTPGLNFLYAHLNRAVAERQQSTIYVTGPGHGGP
GLVASAYLDGTYSEVYSDITEDEEGLRRLFKQFSFPGGIPSHVAPETPGSIHEGGELGYA
LSHAYGAAFDNPHLLVAAVVGDGEAETGPLATSWHSNKFVNPAQDGMVLPILHLNGYKIA
NPTVLDRISDGELRDLMVGYGHTPHVFEAGFDDEDDLSIHRRFAVLLDEVLDEIAAIKER
AAGGDLTRPMYPMIVFRTPKGWTGPAEIDGKKTTGSWRAHQVPLASARDTPEHLAVLEDW
LQSYGPDELFDADGRVDDEIRALAPVGDLRMSANPHANGGLLLRDLRLPDFRDFAQDVPT
PASTFAEAPRVLGEYLTEVIRRNPDNFRIFGPDETASNRLQAVYEVTAKQWNADFEGPEV
DDHLERAGRVMEMLSEHQCQGWLEGYLLTGRHGLFTSYEAFIHIVDSMFNQHAKWLKVTN
HIPWRRPVASLNYLLSSHVWRQDHNGFSHQDPGFIDHVVNKKAEVVRVYLPPDANTLLST
YDHCLRSRQYVNVVVSGKQPAPNFLSMDEAVAHCTRGLGIWEWAGSEAQDEEPDVVLACA
GDVPTLEVLAAADILRRELPQLKVRVVNVVDLMRLQDAREHPHGLTDAEFDTIFTADRPI
VFAYHGYPWLIHRLTYRRNGHANIHVRGYKEEGTTTTPFDMVMLNDLDRYHLVIDVIDHV
HWARASQAGLRQRMVDARIRARQWTREHGEDIPEVRDWVWPDVGDTATEDGGPTQTRTAV
ADTGGDNE
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaccacgtcggacccgcagcggacgggcgccggcccgatcgcccccgggcag
ttcgccgccgccgaggcgcggaccgcctggcgcaggggcacgggcgaggtcgacgacgcg
accctgcagcgcatcgagaagttctggcgcgcggccaactacctgtcggtcggccagatc
tacctgctcgacaacccgctgctgcgccgcccgctgagccgggacgacgtcaagccgcgc
ctgctgggccactggggcacgacgccgggcctgaacttcctctacgcgcacctcaaccgc
gcggtcgcggagcggcagcagtcgacgatctacgtcaccggcccgggacacggcgggccc
ggcctggtcgccagcgcctacctcgacggcacgtactccgaggtctactcggacatcacg
gaggacgaggaggggctgcgccggctgttcaagcagttctccttccccggcggcatcccg
tcgcacgtcgctccggagacccccggctcgatccacgagggcggcgagctcggctacgcg
ctgagccacgcgtacggcgcggcgttcgacaacccgcacctgctggtcgcggcggtcgtc
ggcgacggcgaggcggagacgggcccgctggcgacgagctggcactcgaacaagttcgtc
aacccggcccaggacggcatggtgctgccgatcctgcacctgaacggctacaagatcgcg
aacccgacggtcctggaccgcatcagcgacggcgagctgcgcgacctcatggtcgggtac
gggcacacgccccacgtcttcgaggcgggcttcgacgacgaggacgacctgtcgatccac
cggcgcttcgccgtcctgctcgacgaggtgctcgacgagatcgccgccatcaaggagcgc
gcggcgggtggtgatctcacccggccgatgtacccgatgatcgtgttccgcacgccgaag
ggctggacgggacccgcggagatcgacggcaagaagacgacgggctcgtggcgcgcgcac
caggtgccgctcgcgagcgcgcgcgacacgccggagcacctcgcggtgctcgaggactgg
ctgcagtcgtacgggcccgacgagctgttcgacgcggacggtcgcgtcgatgacgagatc
cgcgcgctggcgccggtcggcgacctgcggatgagcgccaacccgcacgccaacggcggg
ctcctgctgcgcgacctgcggctgccggacttccgggacttcgcgcaggacgtgcccacg
ccggcctcgacgttcgcggaggcgccgcgcgtcctgggcgagtacctgaccgaggtcatc
cgccggaaccccgacaacttccggatcttcggccccgacgagaccgcgtcgaaccgcctg
caggccgtctacgaggtcaccgccaagcagtggaacgcggacttcgaggggccggaggtc
gacgaccacctggagcgtgccgggcgcgtcatggagatgctgtcggagcaccagtgccag
ggctggctggagggctacctgctgacggggcggcacggcctgttcacctcctacgaggcg
ttcatccacatcgtcgactcgatgttcaaccagcacgcgaagtggctgaaggtcaccaac
cacatcccgtggcggcggccggtcgcgagcctgaactacctgctgtcgagccacgtgtgg
cgtcaggaccacaacggcttcagccaccaggaccccggcttcatcgaccacgtggtcaac
aagaaggccgaggtcgtgcgggtctacctgccgccggacgcgaacacgctgctgagcacg
tacgaccactgcctgcgcagccggcagtacgtcaacgtcgtcgtgtccggcaagcagccc
gcccccaacttcctgtcgatggacgaggccgtcgcgcactgcacgcgcggcctgggcatc
tgggagtgggccgggtcggaggctcaggacgaggagccggacgtcgtcctcgcgtgcgcc
ggcgacgtcccgacgctcgaggtgctggcggcggcggacatcctgcggcgcgagctgccg
cagctcaaggtgcgcgtcgtcaacgtcgtggacctcatgcggctgcaggacgcgcgcgag
cacccgcacgggctgacggacgcggagttcgacacgatcttcacggccgaccgtccgatc
gtgttcgcgtaccacggctacccgtggctgatccaccgtctgacgtaccgtcgcaacggg
cacgcgaacatccacgtgcgcgggtacaaggaggagggcaccaccacgacgcccttcgac
atggtgatgctcaacgacctcgaccggtaccacctggtcatcgacgtcatcgaccacgtg
cactgggcgcgggcgtcgcaggcgggcctgcgccagcgcatggtcgacgcccgcatccgc
gcccggcagtggacgcgcgagcacggggaggacatccccgaggtgcgcgactgggtctgg
ccggacgtcggcgacacggcgaccgaggacggcggccccacgcagacgcgcaccgcggtc
gccgacaccggcggggacaacgagtag

DBGET integrated database retrieval system