KEGG   Cellulomonas flavigena: Cfla_2621Help
Entry
Cfla_2621         CDS       T01230                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:cfl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cfl00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cfl00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2932393..2933166
Genome map
AA seq 257 aa AA seqDB search
MPHPSEPSTLAVDCGGSGIKASVLDAAGTLHAPAVRVPTPYPLPPDRLAETIAQIATRLP
TAQRATVGVPGMIRHGVVVATPHYVTRSGPRSAVLPELRDAWVGCDVQALLTARLGVPTL
VLNDAEVHGAGVVAGTGLELVLTLGTGLGSALFDGGRLAPHLELSHAPVRWGTTYDAYVG
EHERARLGDGLWSRRVRRVVEGFRPVFHWDRLYLGGGNSRRITPATLERLGDDVVVVPNQ
AGIVGGVRAWELVERER
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgccccacccgtccgagccgtccaccctcgccgtcgactgcggcggcagcggcatcaag
gcgtccgtcctcgacgccgccggcaccctgcacgcccccgccgtccgcgtccccacgccg
tacccgctgccgccggaccggctggcggagacgatcgcgcagatcgcgacgcgcctgccc
accgcgcagcgcgcgaccgtcggcgtgccgggcatgatccgccacggcgtcgtcgtcgcc
acaccgcactacgtcacccgctccgggccgcgcagcgccgtgctgcccgagctgcgcgac
gcgtgggtcgggtgcgacgtgcaggcgttgctgaccgcgcgtctcggtgtgccgacgctc
gtgctcaacgacgccgaggtgcacggcgcgggcgtcgtcgccgggacgggcctggagctc
gtgctgaccctcgggacgggcctgggctccgcgctgttcgacggcggacggctcgcgccg
cacctcgagctgtcgcacgcccccgtgcggtggggcacgacgtacgacgcgtacgtcggc
gagcacgagcgcgcccggctcggcgacgggctgtggtcgcgccgcgtccgcagggtcgtc
gagggcttccgccccgtcttccactgggaccgcctctacctcggcggcggcaactcccgg
cgcatcacgcccgcgacgctcgagcggctcggcgacgacgtcgtcgtcgtgccgaaccag
gcgggcatcgtcggcggcgtgcgcgcgtgggagctggtcgagcgcgagcgctga

DBGET integrated database retrieval system