KEGG   Cellulomonas flavigena: Cfla_2810Help
Entry
Cfla_2810         CDS       T01230                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_2810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_2810
   00620 Pyruvate metabolism
    Cfla_2810
   00640 Propanoate metabolism
    Cfla_2810
  Energy metabolism
   00680 Methane metabolism
    Cfla_2810
Enzymes [BR:cfl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cfla_2810
Lipid biosynthesis proteins [BR:cfl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cfla_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3123315..3125339
Genome map
AA seq 674 aa AA seqDB search
MTEPSTAPTSPDAPQGSPGLENLLTEERRFPPSAQFAAQANATADAYAWANADRPGFWAD
QARELLTWSTPFTQTLDWSDAPFARWFADGRLNAAYNAVDRHVEQGRGDRVALHFEGEGG
DTRTLTYADLQREVSRAANAITALGVGTGDRVAIYLPLIPEAVVTMLACARIGAPHSVVF
GGFSAEALSSRILDAEAKLVVTADGGFRRGKPSALKPAVDEALAKDAPSVQHVLVVRRTG
QPVEWTPGRDVWWHDAVEAASAQHTPVDVEAEHPLFILYTSGTTGKPKGIFHTTGGYLTQ
AAYTHLNVFDLKPETDVYWCTADIGWITGHTYVVYGPLVNGATQVIYEGTPDTPHRGRWW
EIVQKYGVTILYTAPTAIRTCMKWGEEIPSQFDLSTLRVLGSVGEPINPEAWMWYRRVIG
GDKAPIVDTWWQTETGAIMISPLPGVTETKPGSAQVPLPGIAADVVDDEAHSVPNGGGGY
LVLTEPWPAMLRGIWGDPERYRDTYWSRFANTYFAGDGAKKDEDGDIWLLGRVDDVMNVS
GHRLSTTEIESALVSHPWVAEAAVVGATDETTGQAVVAFVILRGDVAEGTAADAATVQET
LRTHVAKEIGPIAKPRQILVVPELPKTRSGKIMRRLLRDIAEHRQVGDATTLADSSVMDL
IAQGLAKPAAASED
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaccctcgaccgcccccacgtcgcccgacgccccgcagggatcgcccggcctc
gagaacctcctcacggaggagcggcgcttccccccgtccgcgcagttcgcggcacaggcc
aacgccaccgccgacgcgtacgcgtgggcgaacgccgaccggccggggttctgggcggac
caggcccgggagctgctcacgtggtccacgccgttcacgcagacgctcgactggtcggac
gcgccgttcgcccggtggttcgcggacggccggctcaacgccgcctacaacgccgtcgac
cggcacgtcgagcaggggcgcggcgaccgggtggcgctgcacttcgagggcgagggcggc
gacacccgcacgctgacgtacgccgatctccagcgcgaggtgtcgcgggcggcgaacgcg
atcaccgcgctcggtgtcggcacgggcgaccgcgtcgcgatctacctgccgctgatcccc
gaggccgtcgtcacgatgctcgcgtgcgcccggatcggcgcgccgcactcggtggtcttc
ggtgggttctcggccgaggcgctgagctcgcgcatcctcgacgccgaggccaagctcgtc
gtcaccgccgacggcgggttccggcggggcaagccctcggcgctcaagccggcggtcgac
gaggcgctcgccaaggacgcgccgagcgtgcagcacgtgctggtggtgcggcgcaccggg
cagcccgtggagtggacaccggggcgtgacgtctggtggcacgacgcggtggaggccgcg
tccgcgcagcacacacccgtcgacgtcgaggcggagcacccgctgttcatcctgtacacg
tccggcaccacggggaagccgaagggcatcttccacaccaccggcgggtacctcacgcag
gccgcgtacacgcacctcaacgtcttcgacctcaagcccgagacggacgtctactggtgc
acggccgacatcggctggatcaccgggcacacctacgtcgtctacggaccgctcgtcaac
ggcgcgacgcaggtcatctacgagggcacgcccgacaccccgcaccgcgggcgctggtgg
gagatcgtgcagaagtacggcgtgacgatcctctacaccgccccgacagcgatccggacg
tgcatgaagtggggcgaggagatcccctcgcagttcgatctgtcgacgctgcgggtcctg
ggatcggtgggcgagcccatcaaccccgaggcgtggatgtggtaccgccgggtcatcgga
ggcgacaaggccccgatcgtcgacacgtggtggcagaccgagacgggcgcgatcatgatc
agcccgctgccgggcgtcaccgagacgaagcccgggtccgcccaggtgccgctgcccggc
atcgccgcggacgtcgtcgacgacgaggcgcactcggtgccgaacggcggtggcggctac
ctcgtgctgaccgagccgtggcccgcgatgctgcgcgggatctggggcgacccggagcgg
tacagggacacctactggtcacggttcgcgaacacgtacttcgccggtgacggcgccaag
aaggacgaggacggcgacatctggctgctgggccgggtcgacgacgtcatgaacgtctcg
ggccaccggctgtcgaccacggagatcgagtccgcgctcgtgtcccacccgtgggtcgcg
gaggcggccgtcgtcggtgcgaccgacgagacgacgggccaggcggtcgtcgcgttcgtc
atcctgcgcggcgacgtcgccgagggcaccgcggccgacgcggcgaccgtgcaggagacg
ctgcgcacgcacgtcgccaaggagatcggcccgatcgccaagccgcggcagatcctcgtg
gtccccgagctgcccaagacgcggtccggcaagatcatgcggcgcctgctgcgcgacatc
gccgagcaccggcaggtcggcgacgcgacgacgctggcggactcgtccgtcatggacctc
atcgcgcaggggctggcgaagcccgcggcggcgtcggaggactga

DBGET integrated database retrieval system