KEGG   Cellulomonas flavigena: Cfla_2810Help
Entry
Cfla_2810         CDS       T01230                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00010  Glycolysis / Gluconeogenesis
cfl00620  Pyruvate metabolism
cfl00640  Propanoate metabolism
cfl00680  Methane metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_2810
   00620 Pyruvate metabolism
    Cfla_2810
   00640 Propanoate metabolism
    Cfla_2810
  Energy metabolism
   00680 Methane metabolism
    Cfla_2810
Enzymes [BR:cfl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cfla_2810
Lipid biosynthesis proteins [BR:cfl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cfla_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADG75695
UniProt: D5UJQ7
Position
3123315..3125339
Genome map
AA seq 674 aa AA seqDB search
MTEPSTAPTSPDAPQGSPGLENLLTEERRFPPSAQFAAQANATADAYAWANADRPGFWAD
QARELLTWSTPFTQTLDWSDAPFARWFADGRLNAAYNAVDRHVEQGRGDRVALHFEGEGG
DTRTLTYADLQREVSRAANAITALGVGTGDRVAIYLPLIPEAVVTMLACARIGAPHSVVF
GGFSAEALSSRILDAEAKLVVTADGGFRRGKPSALKPAVDEALAKDAPSVQHVLVVRRTG
QPVEWTPGRDVWWHDAVEAASAQHTPVDVEAEHPLFILYTSGTTGKPKGIFHTTGGYLTQ
AAYTHLNVFDLKPETDVYWCTADIGWITGHTYVVYGPLVNGATQVIYEGTPDTPHRGRWW
EIVQKYGVTILYTAPTAIRTCMKWGEEIPSQFDLSTLRVLGSVGEPINPEAWMWYRRVIG
GDKAPIVDTWWQTETGAIMISPLPGVTETKPGSAQVPLPGIAADVVDDEAHSVPNGGGGY
LVLTEPWPAMLRGIWGDPERYRDTYWSRFANTYFAGDGAKKDEDGDIWLLGRVDDVMNVS
GHRLSTTEIESALVSHPWVAEAAVVGATDETTGQAVVAFVILRGDVAEGTAADAATVQET
LRTHVAKEIGPIAKPRQILVVPELPKTRSGKIMRRLLRDIAEHRQVGDATTLADSSVMDL
IAQGLAKPAAASED
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaaccctcgaccgcccccacgtcgcccgacgccccgcagggatcgcccggcctc
gagaacctcctcacggaggagcggcgcttccccccgtccgcgcagttcgcggcacaggcc
aacgccaccgccgacgcgtacgcgtgggcgaacgccgaccggccggggttctgggcggac
caggcccgggagctgctcacgtggtccacgccgttcacgcagacgctcgactggtcggac
gcgccgttcgcccggtggttcgcggacggccggctcaacgccgcctacaacgccgtcgac
cggcacgtcgagcaggggcgcggcgaccgggtggcgctgcacttcgagggcgagggcggc
gacacccgcacgctgacgtacgccgatctccagcgcgaggtgtcgcgggcggcgaacgcg
atcaccgcgctcggtgtcggcacgggcgaccgcgtcgcgatctacctgccgctgatcccc
gaggccgtcgtcacgatgctcgcgtgcgcccggatcggcgcgccgcactcggtggtcttc
ggtgggttctcggccgaggcgctgagctcgcgcatcctcgacgccgaggccaagctcgtc
gtcaccgccgacggcgggttccggcggggcaagccctcggcgctcaagccggcggtcgac
gaggcgctcgccaaggacgcgccgagcgtgcagcacgtgctggtggtgcggcgcaccggg
cagcccgtggagtggacaccggggcgtgacgtctggtggcacgacgcggtggaggccgcg
tccgcgcagcacacacccgtcgacgtcgaggcggagcacccgctgttcatcctgtacacg
tccggcaccacggggaagccgaagggcatcttccacaccaccggcgggtacctcacgcag
gccgcgtacacgcacctcaacgtcttcgacctcaagcccgagacggacgtctactggtgc
acggccgacatcggctggatcaccgggcacacctacgtcgtctacggaccgctcgtcaac
ggcgcgacgcaggtcatctacgagggcacgcccgacaccccgcaccgcgggcgctggtgg
gagatcgtgcagaagtacggcgtgacgatcctctacaccgccccgacagcgatccggacg
tgcatgaagtggggcgaggagatcccctcgcagttcgatctgtcgacgctgcgggtcctg
ggatcggtgggcgagcccatcaaccccgaggcgtggatgtggtaccgccgggtcatcgga
ggcgacaaggccccgatcgtcgacacgtggtggcagaccgagacgggcgcgatcatgatc
agcccgctgccgggcgtcaccgagacgaagcccgggtccgcccaggtgccgctgcccggc
atcgccgcggacgtcgtcgacgacgaggcgcactcggtgccgaacggcggtggcggctac
ctcgtgctgaccgagccgtggcccgcgatgctgcgcgggatctggggcgacccggagcgg
tacagggacacctactggtcacggttcgcgaacacgtacttcgccggtgacggcgccaag
aaggacgaggacggcgacatctggctgctgggccgggtcgacgacgtcatgaacgtctcg
ggccaccggctgtcgaccacggagatcgagtccgcgctcgtgtcccacccgtgggtcgcg
gaggcggccgtcgtcggtgcgaccgacgagacgacgggccaggcggtcgtcgcgttcgtc
atcctgcgcggcgacgtcgccgagggcaccgcggccgacgcggcgaccgtgcaggagacg
ctgcgcacgcacgtcgccaaggagatcggcccgatcgccaagccgcggcagatcctcgtg
gtccccgagctgcccaagacgcggtccggcaagatcatgcggcgcctgctgcgcgacatc
gccgagcaccggcaggtcggcgacgcgacgacgctggcggactcgtccgtcatggacctc
atcgcgcaggggctggcgaagcccgcggcggcgtcggaggactga

DBGET integrated database retrieval system