KEGG   Cellulomonas flavigena: Cfla_2836Help
Entry
Cfla_2836         CDS       T01230                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cfla_2836
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_2836
  Lipid metabolism
   00071 Fatty acid degradation
    Cfla_2836
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cfla_2836
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cfla_2836
   00626 Naphthalene degradation
    Cfla_2836
Enzymes [BR:cfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cfla_2836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3152379..3153440)
Genome map
AA seq 353 aa AA seqDB search
MGLDEGVRAVVVEAFGVVPEVRDVPDPVCPRDGVVVRVAATGVCRSDWHAWQGHDDDVTL
PHVPGHELAGTIVEVGPDVRAWQVGDVVTVPFVMACGTCATCRAGDQQVCPHQTQPGFTQ
WGSFAELVALDHADTNLVRVPEGMSPVAAAALGCRFATSYRAVTVHAAVRPHDEVVVLGC
GGVGLSAVMVAAAAGAHVVAVDPSPGARRAAHDAGAHTTLDPGADDPEALAARLVEATGG
GAHATLDALGSAATAQAGVLALRRRGRHVQVGLLLRDDARTALPMDRVVAWELSVHGSHG
MAAHEYPAMLAAIAEGRLAPATLVSRTIPLEDAPGALAGLPTSAPGGMTVVVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtggggttggatgagggtgtgcgtgcggtcgtggtggaggcgttcggggtcgtgccggag
gtccgggacgtcccggacccggtctgcccgcgggacggggtcgtggtgcgggtcgccgcc
accggcgtctgccgcagcgactggcacgcgtggcaggggcacgacgacgacgtgacgctg
ccgcacgtgccggggcacgagctcgccggcacgatcgtggaggtcgggcccgacgtccgc
gcctggcaggtcggcgacgtcgtcaccgtcccgttcgtcatggcgtgcgggacgtgcgcg
acgtgccgcgccggcgaccagcaggtctgcccgcaccagacgcagcccgggttcacgcag
tggggctccttcgccgagctcgtcgcgctcgaccacgcggacaccaacctcgtgcgcgtc
cccgagggcatgtcgcccgtcgctgccgccgcgctcggctgccggttcgcgacgtcgtac
cgcgccgtcaccgtgcacgcggcggtgcgcccccacgacgaggtcgtcgtgctcgggtgc
ggcggcgtgggcctgtccgccgtcatggtcgccgccgcggccggcgcgcacgtcgtcgcc
gtcgacccgtccccgggtgcacgccgggccgcgcacgacgcgggcgcgcacacgaccctc
gaccccggcgcggacgaccccgaggcgctcgccgcgcggctggtcgaggcgaccgggggt
ggcgcgcacgccacgctcgacgcgctcggcagcgccgccaccgcgcaggcgggggtgctc
gcgctgcgccgtcgcgggcggcacgtgcaggtcggcctgctgctgcgtgacgacgcccgg
accgcgctgccgatggaccgtgtggtcgcgtgggagctgtccgtgcacggcagccatggc
atggccgcgcacgagtaccccgcgatgctcgccgcgatcgccgaggggcggttggcgccc
gcgacgctcgtcagccgcacgatcccgctcgaggacgccccgggggcgctcgcgggcctg
ccgacgtcggcgccgggaggcatgacggtcgtcgtcccctga

DBGET integrated database retrieval system