KEGG   Cellulomonas flavigena: Cfla_2912Help
Entry
Cfla_2912         CDS       T01230                                 

Definition
1,4-beta cellobiohydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cfl  Cellulomonas flavigena
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cfla_2912
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Cfla_2912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3222752..3224227)
Genome map
AA seq 491 aa AA seqDB search
MHPRSKRPLTTRRKVVAAVAAGAVLAGGVTALTSSIAQAAAGCRVDYAVTSQWPGGFGAA
VTVTNLGDPLSSWELSWTFPDGQGVQQLWNGVHSTSGSNVTVKNMSWNGSVGTNASVQVG
FNGSWNGANNAPTSFTLNGTSCNGAVGGPTTEPTPEPTPEPTPEPTPEPTPEPTPEPTPE
PTPEPTPEPTPEPTPEPTPEPTPEPTMPPVQAGQFHVDTTNQSYRAWQAASGSDKDLLAK
IALTPQAYWVGNWNEASHAQQEVRDITSAAAAAGRTAVLVVYAIPGRDCGQHSSGGVSTS
EYAQWIDTVAQGIVGNPWVVLEPDALPMLGDCDGQGDRVGFLKYAAKSLTAKGARVYIDA
GHSAWLSPSEAANRLNQIGFEDAVGFSINVSNYRTTAESKTWGQQVSQLTGGKKFVIDTS
RNGNGPSGSEWCNPSGRALGERPTLVNDGSGLDALLWIKLPGESDGACNGGPGAGQWWQS
MALELARNAKW
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcacccccgctcgaagagacccctcaccaccagacgcaaggtcgtcgcggccgtcgcg
gccggagccgtcctcgccggcggcgtcaccgccctgacctcgagcatcgcgcaggccgcc
gccggctgccgcgtcgactacgccgtgacgagccagtggcccggtggcttcggtgcagcc
gtcaccgtcacgaacctcggcgacccgctctcgtcctgggagctgagctggacgttcccc
gacggccagggcgtgcagcagctctggaacggcgtgcactcgacctccggttcgaacgtc
accgtgaagaacatgtcgtggaacggttcggtcggcaccaacgccagcgtccaggtcggc
ttcaacggctcctggaacggcgcgaacaacgcgccgacgtccttcacgctcaacggcacc
tcgtgcaacggtgcggtcggtggcccgacgacggagccgacgcccgagccgaccccggag
cccacgcccgagccgacgccggagccgacgcccgagccgacgccggagcccacgcccgag
ccgacgccggagcccacgcccgagccgaccccggagcccacgcccgagcccacgcccgag
cccacgcccgagcccacgatgccgccggtccaggccggtcagttccacgtcgacaccacg
aaccagtcgtaccgcgcctggcaggcggccagcggctccgacaaggacctgctggcgaag
atcgccctgacgccgcaggcgtactgggtcggcaactggaacgaggcctcgcacgcgcag
caggaggtccgtgacatcacgtcggccgctgcggccgccggcaggaccgccgtgctcgtc
gtctacgccatcccgggccgcgactgcggccagcactccagcggcggcgtgtcgacctcc
gagtacgcgcagtggatcgacacggtcgcccagggcatcgtcggcaacccgtgggtggtc
ctcgagcccgacgcgctgccgatgctcggcgactgcgacggccagggcgaccgggtcggc
ttcctcaagtacgccgcgaagtccctgaccgccaagggtgcgcgcgtctacatcgacgcc
ggccactcggcgtggctgtcgccgtcggaggccgcgaaccgcctcaaccagatcgggttc
gaggacgccgtgggcttctcgatcaacgtctccaactaccgcacgacggcggagtcgaag
acctggggtcagcaggtctcgcagctgaccggtggcaagaagttcgtcatcgacacgtcg
cgcaacggcaacggcccgtccgggtcggagtggtgcaacccgagcggccgcgccctcggc
gagcgcccgacgctcgtgaacgacggcagcgggctcgacgcgctgctgtggatcaagctg
cccggtgagtcggacggcgcctgcaacggcggcccgggcgccggtcagtggtggcagtcg
atggcactggagctggcgcgcaacgcgaagtggtga

DBGET integrated database retrieval system