KEGG   Cellulomonas flavigena: Cfla_2995Help
Entry
Cfla_2995         CDS       T01230                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cfl  Cellulomonas flavigena
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Cfla_2995
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Cfla_2995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3319138..3321171)
Genome map
AA seq 677 aa AA seqDB search
MPLPVGDHIRYGGDYNPEQWPVEVWDEDHAAFDLAHVTTLTVGVFAWAHTEPREGRYDFS
RLDAIVERAHREGRDVVLATPSGAMPPWLARAYPDACRVDFEGRRHVHGQRHNHCPSSPD
FRRLSVAMADALAQRYGDHPAVVAWHVGNEYGGACYCDLCAAGFRDWLRARYGTLERLND
AWTTLFWSHVYGDWEEVVPPSMLSEHWRGPNHTAFQGITLDYRRYMSDRLREGFVAERAA
IRAHSSLPATTNLMGFYQPVDYHRWADDLDFVSWDNYPPLPDDPLRTAARMAATHAAMRG
LKDGQPFWVMEQTPSITASRDVNPVKRPGVLGLWTWQSVAHGADATLYFQMRQSKGACEK
YHGALIDHSGRTDTRVFREAADLGAALARTGPALLGARTPARVALLLDWDSWWAVEMTDG
YNRHVSYLQTLLQYHRALWAANAEVDVVPVTADLAAYDVVVAPVLHLLKGDVAARLTAHV
ERGGTLVTTFYGGRVDEDDNAYLGVPPLDPLLGTRVEETDSGLPGAANPVTLVLDDEATT
HDATLVFELLVPEAGTEVIGTYGADFYAGRPAVTRSRRGDGAAWHVATGLDDAGVGRVLR
HVLTGYGLVGPHADDEGVEVTRRVAPDGATFTFVLHHGASPVTVTSQVAGEDLLTGRTVE
VGDALVLEAAEVLVLRG
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
gtgcccctgcccgtcggtgaccacatccgctacggcggtgactacaacccggagcagtgg
ccggtcgaggtctgggacgaggaccacgcggcgttcgacctcgcccacgtcaccacgctc
acggtcggcgtgttcgcgtgggcgcacaccgagccgcgcgaggggcggtacgacttctcg
cggctcgacgcgatcgtcgagcgggcccaccgcgagggacgggacgtggtcctcgccacg
ccgagcggagcgatgccgccgtggctcgcgcgggcctaccccgacgcgtgccgcgtcgac
ttcgagggccgccggcacgtccacgggcagcggcacaaccactgcccgtcgtcgccggac
ttccggagactgtcggtcgcgatggccgatgcgctcgcgcagcggtacggcgaccacccg
gcggtcgtcgcgtggcacgtcggcaacgagtacggcggtgcctgctactgcgacctgtgc
gcggccggcttccgtgactggctgcgcgcgcggtacggcacgctcgagcgtctcaacgac
gcctggaccacgctgttctggtcgcacgtctacggcgactgggaggaggtcgtaccgccg
tcgatgctgtcggagcactggcgcgggccgaaccacacggcgttccagggcatcacgctg
gactaccggcggtacatgtcggaccggctgcgcgaggggttcgtcgccgagcgcgcggcg
atccgcgcgcactcgtcgctgccggcgacgaccaacctcatgggcttctaccagccggtc
gactaccaccgctgggccgacgacctcgacttcgtgtcctgggacaactatccgccgctg
cccgacgacccgctgcgcacggccgcccgcatggccgccacgcacgccgccatgcgcggg
ctgaaggacgggcagccgttctgggtcatggagcagacgccgtcgatcacggcctcgcgc
gacgtcaaccccgtcaagcggcccggcgtcctggggctgtggacgtggcagtccgtcgcg
cacggcgccgacgcgaccctgtacttccagatgcggcagtcgaagggcgcgtgcgagaag
taccacggcgcgctcatcgaccactcggggcgcaccgacacgcgtgtcttccgtgaggcg
gcggacctgggggccgccctggcgcgcacggggccggcgctcctgggcgcccggacgccc
gcccgcgtcgcgctgctgctcgactgggactcgtggtgggccgtcgagatgaccgacggg
tacaaccgccacgtgtcgtacctgcagacgctcctgcagtaccaccgggcgctgtgggcg
gcgaacgccgaggtcgacgtggtcccggtgacggcggacctcgcggcgtacgacgtggtc
gtcgcgccggtgctgcacctgctgaagggcgacgtcgccgcacgcctcaccgcgcacgtc
gagcgtggcggcacgctcgtcacgacgttctacggcggacgcgtcgacgaggacgacaac
gcgtacctcggtgtgcccccgctcgacccgctgctcggcacgcgcgtcgaggagacggac
tctgggctcccgggcgccgcgaacccggtgacgctcgtgctcgacgacgaggccacgacg
cacgacgcgacgctcgtgttcgagctgctcgtgccggaggccggcacggaggtgatcggg
acctacggggccgacttctacgcgggccgtcccgcggtgacgcggtcgcggcgcggggac
ggtgcggcgtggcacgtcgcgaccggcctggacgacgcgggcgtcgggcgcgtgctgcgg
cacgtgctcaccgggtacgggctggtcgggccgcacgccgacgacgagggcgtcgaggtc
acgcgccgcgtcgcgcccgacggcgcgaccttcacgttcgtgctgcaccacggggcgtcg
ccggtgaccgtgacgtcacaggtggcgggggaggacctgctgacggggcggaccgtggag
gtgggggacgccctggtgctcgaggcggctgaggtgctggtgctgcgggggtga

DBGET integrated database retrieval system