KEGG   Cellulomonas flavigena: Cfla_3361Help
Entry
Cfla_3361         CDS       T01230                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cfl  Cellulomonas flavigena
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cfla_3361
Enzymes [BR:cfl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Cfla_3361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3735164..3736639)
Genome map
AA seq 491 aa AA seqDB search
MTHGPQLITYADRLAGDLPGLRALLDGPLAGAFGGVHVLPFYPPFDGADAGFDPRDHTQV
DPRLGTWDDVRALGAGREVMADVIVNHVSADSAQFRDVRERGDASPHAPMFLTLGAVFPD
GASEEDLARIYRPRPGLPFTVMTLGGRRRLVWTTFTPDQVDLDLRTPQAWEYLTAVVDAL
TAGGVTMLRLDAVGYTGKEAGTDCFMTPATDAYTERIVSLARARGAQVLVEVHGHHTQQI
EIARKVDLVYDFALPPLVLHALTAADLEPLAGWLAIRPANAVTVLDTHDGIGIVDVGPSD
LRPGEPGLLAPEKIDALVETMHENSGGTSRQATGAAASNLDLYQVNCTFYDALARDDRRY
LLARLLQLFVPGIPQVYYVGLLAGSNDMELLAATGVGRDVNRHHYTDGEVADALARPVVR
AQLAALRLRASHAAFGGAFEWDLDGTRGCLAWTAGDERAVLTFDVADASFTVHATGPDGE
EAVLTDAAVAP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacggcccgcagctcatcacctacgccgaccgcctcgccggggacctgcccggc
ctgcgcgcgctcctcgacgggccgcttgccggcgcgttcggcggcgtgcacgtgctgccg
ttctacccgccgttcgacggcgccgacgccgggttcgacccgcgcgaccacacccaggtc
gacccccgcctgggcacgtgggacgacgtccgcgcgctcggcgccggccgtgaggtgatg
gccgacgtcatcgtcaaccacgtctctgcggactccgcgcagttccgcgacgtgcgcgag
cgcggcgacgcctccccgcacgcgccgatgttcctcacgctcggtgccgtgttccccgac
ggcgcgtcggaggaggacctcgcgcgcatctaccgcccgcgcccgggcctgccgttcacc
gtgatgaccctcggcggtcgcaggcgtctggtgtggacgacgttcacgcccgaccaggtc
gacctcgacctgcggaccccgcaggcgtgggagtacctgacggccgtcgtcgacgcgctc
accgcgggcggtgtgaccatgctgcggctcgacgccgtcgggtacaccggcaaggaggcg
ggcaccgactgcttcatgacgcccgcgaccgacgcgtacaccgagcggatcgtgtcgctg
gcacgcgcgcgcggcgcgcaggtgctcgtcgaggtgcacgggcaccacacgcagcagatc
gagatcgcccgcaaggtcgacctcgtctacgacttcgcgctgccgccgctcgtgctgcac
gcgctcaccgcggccgacctcgagccgctcgccgggtggctggcgatccggccggccaac
gccgtgaccgtgctcgacacgcacgacggcatcggcatcgtcgacgtgggcccgtccgac
ctgcgccccggcgagcccggcctgctggcgccggagaagatcgacgcgctcgtcgagacg
atgcacgagaactccggcggcacgtcgcgccaggccaccggcgcggccgcgtcgaacctc
gacctctaccaggtcaactgcacgttctacgacgcgctcgcgcgcgacgaccgccgctac
ctgctcgcgcggctgctgcagctcttcgtccccgggatcccgcaggtctactacgtgggc
ctgctcgcggggtccaacgacatggagctgctggccgccacgggtgtgggacgcgacgtc
aaccggcaccactacacggacggcgaggtggccgacgccctggcgcggcccgtggtgcgg
gcgcagctcgcggcactgcggctgcgggcgtcgcacgcggcgttcggcggcgcgttcgag
tgggacctcgacggcacgcgcggctgtctcgcgtggacggcgggcgacgagcgcgcggtc
ctgacgttcgacgtggccgacgcgtcgttcacggtgcacgcgacgggcccggacggcgag
gaggcggtcctcaccgacgcggccgtcgcaccctga

DBGET integrated database retrieval system