KEGG   Cellulomonas flavigena: Cfla_3380Help
Entry
Cfla_3380         CDS       T01230                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cfl  Cellulomonas flavigena
Pathway
cfl00010  Glycolysis / Gluconeogenesis
cfl00020  Citrate cycle (TCA cycle)
cfl00620  Pyruvate metabolism
cfl01100  Metabolic pathways
cfl01110  Biosynthesis of secondary metabolites
cfl01120  Microbial metabolism in diverse environments
cfl01130  Biosynthesis of antibiotics
cfl01200  Carbon metabolism
Module
cfl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_3380
   00020 Citrate cycle (TCA cycle)
    Cfla_3380
   00620 Pyruvate metabolism
    Cfla_3380
Enzymes [BR:cfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cfla_3380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADG76259
UniProt: D5UCM4
Position
complement(3757660..3759099)
Genome map
AA seq 479 aa AA seqDB search
MPTYQQFPLPDAGEGLTEAEIVTWLVAVGDRVEVNQTIVEIETAKSLVELPCPWTGVVSR
LLVEPGTTVEVGTPIIEVDTDPDGPAPAAGAEGAGQPGVRARHPHESRASSEPGGADEVG
AARDELHAASGEPAGSGAVLVGYGVAEGGAARRRRVEPAADGAAPAPAPAPLPPSSRTTH
ALAKPPVRKLARDLGVDLDAVTPTGPGGIVTREDVLAHSVRAEGRELATYPGDDRPWAAG
GVVSPDGRQTRVPVKSVRKRTAEAMVSSAFSAPHVTVFHTVDVTRTMKLVERLRGDREFT
DVRVTPLLIAAKALLLAVDRHPEINASWDEDAREIVYKHYVNLGIAAATPRGLVVPNIKD
AHRLDLLGLARGLGELTATARAGRTSPADMSDGTITITNVGVFGIDTGTPILNPGEAAIL
AFGAIRLQPWVHKGKVRPRHVTQLALSFDHRLVDGELGSRVLADVAAVLADPAQALVWG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgcccacgtaccagcagttccccctgcccgacgccggcgagggcctgaccgaggccgag
atcgtcacctggctcgtcgccgtcggcgaccgcgtcgaggtcaaccagacgatcgtcgag
atcgagacggccaagtcgctcgtcgagctgccgtgcccgtggacgggcgtcgtgtcgcgc
ctgctcgtcgagcccggcacgaccgtcgaggtcgggacgccgatcatcgaggtcgacacc
gacccggacggcccggcgcccgcggcgggtgccgagggcgcgggacagcccggtgtgcgg
gcgcggcacccgcacgagagccgtgcgtcgagcgagccgggcggtgccgacgaggtcggt
gcggcgcgcgacgagctgcacgcggcgtcgggggagcctgccgggtccggggcggtgctc
gtcgggtacggcgtggccgagggcggtgccgcgcggcggcggcgcgtggagccggctgcg
gacggtgctgcgccggcaccggcgccggcgccgctgcccccgtcgtcccgcacgacgcac
gcgctcgccaagccgcccgtccgcaagctcgcacgcgacctgggcgtcgacctcgacgcc
gtcaccccgacgggccccggggggatcgtcacgcgcgaggacgtgctggcgcactcggtg
cgcgcggagggccgcgagctcgcgacgtacccgggcgacgaccgtccgtgggccgccggc
ggagtggtcagccccgacggccgccagacgcgtgtgcccgtgaagtccgtgcgcaagcgc
accgccgaggcgatggtgtcgagcgcgttcagcgcaccgcacgtcacggtgttccacacg
gtcgacgtcacgcggaccatgaagctcgtcgagcggctgcgcggcgaccgggagttcacg
gacgtgcgcgtgacgccgctgctgatcgccgccaaggcgctgctgctcgcggtcgaccgg
cacccggagatcaacgcgtcctgggacgaggacgcgcgggagatcgtctacaagcactac
gtgaacctcgggatcgcggcggcgaccccgcgcgggctcgtcgtgccgaacatcaaggac
gcgcaccggctcgacctgctgggcctcgcccgcgggctcggtgagctcacggccaccgcc
cgggcgggccgcacgtcgcccgccgacatgtcggacggcacgatcacgatcaccaacgtc
ggggtcttcggcatcgacaccggcacgcccatcctcaacccgggcgaggccgccatcctc
gccttcggggccatccggctgcagccgtgggtgcacaagggcaaggtcaggccgcggcac
gtcacgcagctcgccctgagcttcgaccaccggctcgtcgacggcgagctcggcagccgc
gtgctggccgacgtcgccgcggtcctcgccgacccggcccaggccctcgtctggggctga

DBGET integrated database retrieval system