KEGG   Cellulomonas flavigena: Cfla_3438Help
Entry
Cfla_3438         CDS       T01230                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cfl  Cellulomonas flavigena
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cfla_3438
Enzymes [BR:cfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cfla_3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3831374..3832462
Genome map
AA seq 362 aa AA seqDB search
MTPDRPPLDEHVATPTAGPAAASGPLTGWRVLVPRPPLDPTPTPPSPASRRSTPTPTPPS
PASRRSTPTPTPPSPASRRSTPTPTPPSPASRRSSPAGGFSPAAVALLAAGGEPLVVPLV
RTVPVDDLSPLDDALLALGAGWYSWLTVTSQAAVAVLAEQAAAHDDGLAALVERGGARVG
AVGPGTARALEGLGVRVDVVPPVRSTAVDLVAALVAAAPGTRPDAGPRTLFPRGDLAAPT
LADGLTAAGWAVDDLVVYRTVPAGPPDPQVADAWAGGDVHAALLTSASSVRALLDHLGPP
PPATRVVVIGPSTETEARRMGLRVDAVAGRQTLAGLVDALVAHVAATGARPGSPPTPVED
TP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaccggccgcccctcgacgagcacgtcgcgacccccaccgccggccccgcg
gcggcgtcgggccccctcaccgggtggcgcgtcctggtcccccgcccacccctcgacccc
acccccacccctccctcccccgcgagccgtcgatcgacccccacccccacccctccctcc
cccgcgagccgtcgatcgacccccacccccacccctccctcccccgcgagccgtcgatcg
acccccacccccacccctccctcccccgcgagccgtcgatcgagccccgcgggagggttc
agcccagcggcggtcgcgctgctggcggcgggcggcgagccgctcgtggtgccgctcgtg
cggaccgtgcccgtcgacgacctctccccgctggacgacgccctgctcgccctcggcgcc
gggtggtactcgtggctgaccgtgacgagccaggcggcggtcgcggtgctcgccgagcag
gcggcggcgcacgacgacgggctcgcggccctggtcgagcgcggcggtgcccgcgtcggt
gccgtcgggcccgggacggcgcgcgcgctcgagggactcggcgtccgggtcgacgtcgtg
ccacccgtgcggtcgacggccgtggacctcgtcgccgcgctcgtcgccgctgcccccggc
acccgcccggacgccgggccccgcaccctgttcccgcgcggcgacctcgcggcccccacg
ctcgccgacggcctgaccgccgccggctgggccgtcgacgacctcgtcgtctaccgcacg
gtcccggccggtccgcccgatccccaggtcgccgacgcctgggcggggggcgacgtgcac
gcggccctgctgacgtccgcgagcagcgtccgcgccctgctcgaccacctcggcccgccg
ccgccggcgacgcgcgtcgtcgtcatcggccccagcaccgagacggaggcgcgccgcatg
ggtctgcgcgtcgacgccgtcgccgggcggcagaccctcgccgggctcgtcgacgcgctc
gtcgcgcacgtcgccgccaccggcgcgcgccccggctccccgcccacccccgtggaggac
accccgtga

DBGET integrated database retrieval system