KEGG   Cellulomonas flavigena: Cfla_3439Help
Entry
Cfla_3439         CDS       T01230                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cfl  Cellulomonas flavigena
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cfla_3439
Enzymes [BR:cfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cfla_3439
Exosome [BR:cfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cfla_3439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3832459..3833451
Genome map
AA seq 330 aa AA seqDB search
MTIPAPGRIRPRRLRRTPALRRLAAQTRLHPADLVLPVFVREGLDEPRPLTSMPGVLQHT
RDSLRHEAARAVEAGIGGIMLFGVPAHRDAVGSGATDPDGILNVAVRDVVAEVGDALVVQ
ADLCLDEFTDHGHCGVLTPSGVVDNDATLERYAAMALAQAEAGAHLVGLSGMMDGQTGVV
RDALDAAGHHDVAVLAYAAKYASAFYGPFREAVESQLEGDRRTYQMDPANRREAAREVAI
DVAEGADVVMVKPAMSYLDVLADVAASSPVPVWAYQVSGEYAMIEAAAARGWIARRSAVT
ESVLSIRRAGADAILTYWATELAGWLAEEQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatccccgcccccggccgcatccggccccgccgcctgcggcgcacccccgcgctg
cggcgcctggccgcgcagacccgactgcacccggcggacctcgtgctgcccgtgttcgtc
cgcgagggcctcgacgagccccgcccgctgacctccatgccgggcgtcctgcagcacacc
cgcgactcgctgcgccacgaggcggcgcgcgcggtggaggccggcatcggcgggatcatg
ctgttcggcgtgcccgcgcaccgcgacgcggtcgggtccggcgccaccgaccccgacggc
atcctcaacgtcgccgtccgggacgtcgtcgcggaggtcggcgacgcgctcgtcgtgcag
gccgacctgtgcctcgacgagttcaccgaccacggacactgcggcgtcctcacgccgtcg
ggagtcgtcgacaacgacgcgacgctcgagcggtacgccgccatggcgctcgcgcaggcc
gaggccggcgcccacctcgtggggctcagcggcatgatggacgggcagacgggcgtggtg
cgggacgcgctcgacgccgccggccaccacgacgtcgcggtgctcgcgtacgccgcgaag
tacgcgtcggcgttctacgggccgttccgcgaggccgtcgagtcgcagctcgagggtgac
cgccgcacctaccagatggaccccgcgaaccgccgcgaggccgcccgcgaggtcgcgatc
gacgtggccgagggcgccgacgtcgtcatggtgaagcccgcgatgtcgtacctcgacgtg
ctcgccgacgtggccgcgtcgtcaccggttccggtctgggcgtaccaggtgtccggtgag
tacgcgatgatcgaggcggcggccgcacgggggtggatcgcccgtcggagtgctgtgacc
gagtcggtgctcagcatccgccgggccggtgccgatgccatcctgacgtactgggcgaca
gagctcgccggttggctcgcagaggagcagtga

DBGET integrated database retrieval system