KEGG   Cellulomonas flavigena: Cfla_3475Help
Entry
Cfla_3475         CDS       T01230                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_3475
   00030 Pentose phosphate pathway
    Cfla_3475
   00051 Fructose and mannose metabolism
    Cfla_3475
   00052 Galactose metabolism
    Cfla_3475
  Energy metabolism
   00680 Methane metabolism
    Cfla_3475
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cfla_3475
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Cfla_3475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3866235..3867371
Genome map
AA seq 378 aa AA seqDB search
MAQTKAKRVGILTAGGDSPGLNAAIRGFGKTAIAHYGMELFGFRDGVTGLVENRYVELDG
KALSGILTIGGTILGTSRDKVHRYAVDGGEPQDMVPVVAENYRALGLDALIMLGGGGTAK
NAMRLVDAGLNVVHLPKTIDNDIAETDTTFGFATATEIATDAVDRVHSTAHSHHRIILTE
IMGHRAGWLTLAAGIAGGADIILIPEVPYTIESVAATIRRRTAHGSSFSVVAVAEGARDV
EDTADYEAAQLLVKSAKTPEARRAAKQHLANVEDAQREHTFKLARELEAATGLETRVTIL
GYVQRGGTPCAADRLLATRLGAAAADLVSRGEYGVMVAARGDDAVPVPLSDVAGKVKLVP
PDHAWIQAARQVGTGLGD
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgaaggcgaagcgcgtcgggatcctcacggcaggcggcgacagccctggc
ctcaacgccgcgatccgcgggttcggcaagacggcgatcgcgcactacggcatggagctg
ttcggcttccgggacggcgtcacgggcctggtcgagaaccggtacgtcgagctcgacggc
aaggcgctgtccgggatcctcaccatcggcggcacgatcctggggacgagccgcgacaag
gtgcaccggtacgccgtcgacggtggcgagccgcaggacatggtgccggtggtcgccgag
aactaccgggcgctgggtctcgacgcgctcatcatgctgggcggcggagggaccgcgaag
aacgcgatgcgcctggtcgacgcgggcctcaacgtcgtgcacctgcccaagaccatcgac
aacgacatcgccgagacggacacgacgttcgggttcgcgacggccacggagatcgccacc
gacgcggtcgaccgcgtgcactccacggcgcacagccaccaccgcatcatcctcacggag
atcatggggcaccgggcggggtggctgacgctcgcggcgggcatcgccggcggcgcggac
atcatcctcatccccgaggtcccgtacacgatcgagtcggtcgcggcgacgatccgccgg
cggaccgcgcacgggtcgtcgttctcggtggtcgcggtggcggagggcgcacgggacgtc
gaggacaccgccgactacgaggccgcacagctcctcgtgaagtccgcgaagacgccggag
gcacggcgcgcggcgaagcagcacctggccaacgtcgaggacgcgcagcgcgagcacacc
ttcaagctggcgcgcgagctcgaggccgcgacgggcctggagacgcgggtgacgatcctc
gggtacgtgcagcgcggcgggaccccgtgcgcggcggaccggctgctcgcgacgcggctc
ggcgcggccgccgccgacctggtctcgcgcggcgagtacggcgtcatggtggcggcgcgc
ggcgacgacgcggtcccggtgccgctgtccgacgtcgcgggcaaggtcaagctcgtgccg
ccggaccacgcgtggatccaggcggcccggcaggtggggacgggcctgggcgactga

DBGET integrated database retrieval system