KEGG   Cellulomonas flavigena: Cfla_3475Help
Entry
Cfla_3475         CDS       T01230                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cfla_3475
   01230 Biosynthesis of amino acids
    Cfla_3475
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cfla_3475
   00030 Pentose phosphate pathway
    Cfla_3475
   00051 Fructose and mannose metabolism
    Cfla_3475
   00052 Galactose metabolism
    Cfla_3475
  Energy metabolism
   00680 Methane metabolism
    Cfla_3475
Enzymes [BR:cfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cfla_3475
Protein phosphatases and associated proteins [BR:cfl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Cfla_3475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3866235..3867371
Genome map
AA seq 378 aa AA seqDB search
MAQTKAKRVGILTAGGDSPGLNAAIRGFGKTAIAHYGMELFGFRDGVTGLVENRYVELDG
KALSGILTIGGTILGTSRDKVHRYAVDGGEPQDMVPVVAENYRALGLDALIMLGGGGTAK
NAMRLVDAGLNVVHLPKTIDNDIAETDTTFGFATATEIATDAVDRVHSTAHSHHRIILTE
IMGHRAGWLTLAAGIAGGADIILIPEVPYTIESVAATIRRRTAHGSSFSVVAVAEGARDV
EDTADYEAAQLLVKSAKTPEARRAAKQHLANVEDAQREHTFKLARELEAATGLETRVTIL
GYVQRGGTPCAADRLLATRLGAAAADLVSRGEYGVMVAARGDDAVPVPLSDVAGKVKLVP
PDHAWIQAARQVGTGLGD
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgaaggcgaagcgcgtcgggatcctcacggcaggcggcgacagccctggc
ctcaacgccgcgatccgcgggttcggcaagacggcgatcgcgcactacggcatggagctg
ttcggcttccgggacggcgtcacgggcctggtcgagaaccggtacgtcgagctcgacggc
aaggcgctgtccgggatcctcaccatcggcggcacgatcctggggacgagccgcgacaag
gtgcaccggtacgccgtcgacggtggcgagccgcaggacatggtgccggtggtcgccgag
aactaccgggcgctgggtctcgacgcgctcatcatgctgggcggcggagggaccgcgaag
aacgcgatgcgcctggtcgacgcgggcctcaacgtcgtgcacctgcccaagaccatcgac
aacgacatcgccgagacggacacgacgttcgggttcgcgacggccacggagatcgccacc
gacgcggtcgaccgcgtgcactccacggcgcacagccaccaccgcatcatcctcacggag
atcatggggcaccgggcggggtggctgacgctcgcggcgggcatcgccggcggcgcggac
atcatcctcatccccgaggtcccgtacacgatcgagtcggtcgcggcgacgatccgccgg
cggaccgcgcacgggtcgtcgttctcggtggtcgcggtggcggagggcgcacgggacgtc
gaggacaccgccgactacgaggccgcacagctcctcgtgaagtccgcgaagacgccggag
gcacggcgcgcggcgaagcagcacctggccaacgtcgaggacgcgcagcgcgagcacacc
ttcaagctggcgcgcgagctcgaggccgcgacgggcctggagacgcgggtgacgatcctc
gggtacgtgcagcgcggcgggaccccgtgcgcggcggaccggctgctcgcgacgcggctc
ggcgcggccgccgccgacctggtctcgcgcggcgagtacggcgtcatggtggcggcgcgc
ggcgacgacgcggtcccggtgccgctgtccgacgtcgcgggcaaggtcaagctcgtgccg
ccggaccacgcgtggatccaggcggcccggcaggtggggacgggcctgggcgactga

DBGET integrated database retrieval system