KEGG   Cellulomonas flavigena: Cfla_3475Help
Entry
Cfla_3475         CDS       T01230                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cfl  Cellulomonas flavigena
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cfl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cfl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cfl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cfl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cfl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cfl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cfl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3866235..3867371
Genome map
AA seq 378 aa AA seqDB search
MAQTKAKRVGILTAGGDSPGLNAAIRGFGKTAIAHYGMELFGFRDGVTGLVENRYVELDG
KALSGILTIGGTILGTSRDKVHRYAVDGGEPQDMVPVVAENYRALGLDALIMLGGGGTAK
NAMRLVDAGLNVVHLPKTIDNDIAETDTTFGFATATEIATDAVDRVHSTAHSHHRIILTE
IMGHRAGWLTLAAGIAGGADIILIPEVPYTIESVAATIRRRTAHGSSFSVVAVAEGARDV
EDTADYEAAQLLVKSAKTPEARRAAKQHLANVEDAQREHTFKLARELEAATGLETRVTIL
GYVQRGGTPCAADRLLATRLGAAAADLVSRGEYGVMVAARGDDAVPVPLSDVAGKVKLVP
PDHAWIQAARQVGTGLGD
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgaaggcgaagcgcgtcgggatcctcacggcaggcggcgacagccctggc
ctcaacgccgcgatccgcgggttcggcaagacggcgatcgcgcactacggcatggagctg
ttcggcttccgggacggcgtcacgggcctggtcgagaaccggtacgtcgagctcgacggc
aaggcgctgtccgggatcctcaccatcggcggcacgatcctggggacgagccgcgacaag
gtgcaccggtacgccgtcgacggtggcgagccgcaggacatggtgccggtggtcgccgag
aactaccgggcgctgggtctcgacgcgctcatcatgctgggcggcggagggaccgcgaag
aacgcgatgcgcctggtcgacgcgggcctcaacgtcgtgcacctgcccaagaccatcgac
aacgacatcgccgagacggacacgacgttcgggttcgcgacggccacggagatcgccacc
gacgcggtcgaccgcgtgcactccacggcgcacagccaccaccgcatcatcctcacggag
atcatggggcaccgggcggggtggctgacgctcgcggcgggcatcgccggcggcgcggac
atcatcctcatccccgaggtcccgtacacgatcgagtcggtcgcggcgacgatccgccgg
cggaccgcgcacgggtcgtcgttctcggtggtcgcggtggcggagggcgcacgggacgtc
gaggacaccgccgactacgaggccgcacagctcctcgtgaagtccgcgaagacgccggag
gcacggcgcgcggcgaagcagcacctggccaacgtcgaggacgcgcagcgcgagcacacc
ttcaagctggcgcgcgagctcgaggccgcgacgggcctggagacgcgggtgacgatcctc
gggtacgtgcagcgcggcgggaccccgtgcgcggcggaccggctgctcgcgacgcggctc
ggcgcggccgccgccgacctggtctcgcgcggcgagtacggcgtcatggtggcggcgcgc
ggcgacgacgcggtcccggtgccgctgtccgacgtcgcgggcaaggtcaagctcgtgccg
ccggaccacgcgtggatccaggcggcccggcaggtggggacgggcctgggcgactga

DBGET integrated database retrieval system