KEGG   Cellulomonas flavigena: Cfla_3531Help
Entry
Cfla_3531         CDS       T01230                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cfl  Cellulomonas flavigena
Brite
Enzymes [BR:cfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cfla_3531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3921058..3922476)
Genome map
AA seq 472 aa AA seqDB search
MTTPHHSRRRARIAAVGGLSAAALIVTLAVPAQAAGSTLQAAAAETNRYFGTAMAGHYFN
NSGTMTITNREFNMITAENEMKMDATEPSQNQFSYAAGDQIVNWARQNGKQVRGHALAWH
SQQPGWMQNMSGTTLRNAMLNHVTKVATYYKGKIYAWDVVNEAYADGSSGGRRDSNLQRT
GNDWIEAAFRAARAADPQAKLCYNDYNTDNWSHAKTQGVYNMVRDFKARGVPIDCVGFQA
HFNSGNPVPSNYHTTLGNFAALGVDVQITELDIEGSGTSQAEQFRGIVQACLSVARCTGI
TVWGVKDSDSWRASGTPLLFDGSGNKKAAYTYTLNALNAGGTTATPGGGTSSPAPQPTSS
PSPTANPTTPPPTSGTGTCTATYSEGQKWSDRFNGNVTVRANGNISGWTTTVTLSYPQYI
TAAWGGTASWPQSNVMVMRGNGGLANGQTTTFGFTVQHGGNWTWPTVSCTAS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccccacaccactcgcgccgccgtgcccggatcgcggccgtcggcgggctcagc
gccgccgcgctgatcgtgacgctcgccgtgccggcccaggccgcgggcagcacgctgcag
gccgccgctgccgagaccaaccggtacttcggcacggccatggcagggcactacttcaac
aactccgggacgatgacgatcaccaaccgtgagttcaacatgatcaccgccgagaacgag
atgaagatggacgcgacggagccgtcgcagaaccagttcagctacgcggccggcgaccag
atcgtcaactgggcccgccagaacggcaagcaggtccgtggccacgcgctggcgtggcac
tcccagcagcccgggtggatgcagaacatgtccggcacgaccctgcgcaacgccatgctc
aaccacgtcacgaaggtggcgacgtactacaagggcaagatctacgcctgggacgtggtg
aacgaggcctacgccgacggctcgtccggcgggcgacgtgactccaacctgcagcgcacc
ggcaacgactggatcgaggcggcgttccgcgccgctcgcgccgccgacccgcaggccaag
ctctgctacaacgactacaacaccgacaactggtcgcacgccaagacgcagggcgtctac
aacatggtgcgcgacttcaaggcccgcggtgtcccgatcgactgcgtcggcttccaggcg
cacttcaactcgggcaaccccgtgccgtcgaactaccacaccacgctcggcaacttcgcc
gcgctgggtgtcgacgtgcagatcacggagctcgacatcgagggctccggcacctcgcag
gccgagcagttccggggcatcgtccaggcgtgcctctcggtcgcccgctgcaccggcatc
accgtgtggggcgtgaaggactccgactcgtggcgcgcgtcgggcaccccgctgctgttc
gacggctcgggcaacaagaaggccgcgtacacgtacacgctgaacgcgctcaacgccggc
ggcaccaccgcgaccccgggtggcggcacgtccagcccggcgccgcagccgacatcgagc
ccgtctcccacggccaacccgacgacgcccccgcccaccagcggcaccggcacctgcacg
gcgacgtactccgagggccagaagtggagcgaccgcttcaacggcaacgtgaccgtccgt
gccaacggcaacatcagcggctggacgacgaccgtcacgctgagctacccgcagtacatc
accgcggcctggggcggcacagccagctggccccagtccaacgtcatggtgatgcgcggc
aacggtggcctcgccaacggccagaccacgaccttcgggttcacggtccagcacggcggc
aactggacctggccgacggtcagctgcacggcctcctga

DBGET integrated database retrieval system