KEGG   Cellulomonas flavigena: Cfla_3546Help
Entry
Cfla_3546         CDS       T01230                                 

Definition
fumarate reductase/succinate dehydrogenase flavoprotein domain-containing protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
cfl  Cellulomonas flavigena
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3934904..3936607
Genome map
AA seq 567 aa AA seqDB search
MADAPHVLVVGSGFGGAVAALRLSEKGYRVTVVEAGRRFTPGTLPRTSWDVRRFLWAPRL
GCRGIQRIHVLPDVVLLAGAGVGGGSLVYANTLYRPDSDDFYRDPQWASITDWRAELAPH
YDQAQRMLGVVTNPTSTPADEVVRAAARDLGVADSFRLAPVGVVFGEPGAPVPDPFFGGV
GPERRGCLQCGECMTGCRHGAKNTLETNYLWLAERAGARIVPDTTVASLVPRADGRWDVV
TVPTGRSGPRTHVTADQVVVAAGAWGTQELLHRLKADGTLPHLSDRLGHLTRTNSEALGG
AARRPRARGPRLNSGVAITSSVWLDERTHIEPVRYGHGSNLMALLGTVLTDGGGRVPRWV
RWLGQVARHPGHVLGMLTGLRTWSDRAVIGLVMQTGGASLTVRPRRTWTGRWRLTSTRGD
DAPNPTWLPQANAAYRAMARHLGDGIPMSTLGEIADVPMTAHFLGGCTIGADVSTGVVDA
YHRVFGYPGLHVMDGSTVSANLGVNPSLTITAQAERACAAWPNAGDADPRPAPGEPYRRV
PPVPPSHPVVPAHARAALPLTVVRPEA
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgccccgcacgttctcgtcgtcggctcgggattcggcggcgcggtcgcggcg
ctgcggctgtcggagaaggggtaccgcgtcaccgtcgtcgaggcggggcggcggttcacg
cccggcacgctgccgcgcacgtcgtgggacgtgcggcggttcctgtgggcgccgcgcctg
gggtgccgcgggatccagcggatccacgtgctgccggacgtcgtgctgctcgccggtgcg
ggcgtgggcggtgggtcgctggtgtacgcgaacacgctgtaccggcccgactccgacgac
ttctaccgcgacccgcagtgggcgtcgatcacggactggcgtgcggagctcgcaccgcac
tacgaccaggcgcagcgcatgctcggcgtcgtcacgaaccccacgtcgacccccgcggac
gaggtcgtgcgggccgccgcgcgcgacctgggcgtcgcggactcgtttcgcctcgcgccc
gtcggcgtggtgttcggcgagcccggtgcgcccgtgccggacccgttcttcggcggcgtc
ggcccggagcgccgcggctgcctgcagtgcggcgagtgcatgacgggctgccggcacggc
gccaagaacaccctcgagaccaactacctgtggctcgccgagcgcgcgggcgcgcgcatc
gtccccgacaccacggtcgcgtcactcgtgccgcgcgcggacggacggtgggacgtggtg
acggtcccgacgggccggagcggaccgcgcacgcacgtcaccgctgaccaggtcgtcgtc
gccgccggcgcgtggggcacgcaggagctgctgcaccggctcaaggccgacggcacgctg
ccccatctgtccgaccggctcgggcacctcacgcgcaccaactccgaggcgctcggcggt
gcggcgcgccgtccccgcgcccgcggcccgcgcctgaacagcggggtcgcgatcacgtcg
tccgtctggctcgacgagcgcacccacatcgaacccgtccgctacggccacgggtcgaac
ctcatggcgctgctgggcacggtgctgacggacggcggcgggcgcgtgccgcggtgggtg
cgctggctggggcaggtcgcgcggcacccgggccacgtgctggggatgctgacgggcctg
cggacgtggtccgaccgggccgtcatcgggctcgtcatgcagacgggaggggcgtcgctg
accgtgcggccgcgtcgcacgtggacgggccggtggcgcctgacgtcgacgcgcggcgac
gacgcgcccaaccccacgtggctgccgcaggccaacgccgcgtaccgcgcgatggcccgg
cacctcggcgacggcatcccgatgagcacgctcggcgagatcgcggacgtgccgatgacc
gcgcacttcctgggcgggtgcaccatcggcgccgacgtctcgaccggtgtcgtcgacgcc
taccaccgcgtcttcgggtaccccgggctgcacgtcatggacggctcgaccgtctccgcg
aacctcggtgtgaacccgtcgctgacgatcacggcgcaggccgagcgtgcgtgcgcggcc
tggccgaacgcgggcgacgcggacccgcggccggcacccggcgagccgtaccgccgggtc
ccgccggtgccgccgagccacccggtcgtcccggcgcacgcgcgggcggcgctgccgctg
acggtcgtgcgcccggaagcgtga

DBGET integrated database retrieval system