KEGG   Corynebacterium falsenii: CFAL_00710Help
Entry
CFAL_00710        CDS       T03037                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
cfn  Corynebacterium falsenii
Pathway
cfn00790  Folate biosynthesis
cfn01100  Metabolic pathways
cfn02020  Two-component system
Module
cfn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cfn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CFAL_00710
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CFAL_00710
Enzymes [BR:cfn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CFAL_00710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N TAT_signal
Motif
Other DBs
NCBI-ProteinID: AHI02317
UniProt: W5WP55
Position
complement(166574..168319)
Genome map
AA seq 581 aa AA seqDB search
MSDTSPSARSAVPRRRVLQTGAVGAAALGLSAALPPSASANAPAAPVAGAPAPGSAGSAF
QHGVASGDPYPTSVILWTRITSNDADYPGLGKGTPTAVTWEVAPDEGFGTIVSSGSATAT
PDTDMTVKVEAANLQPYTPYFYRFTVADGEKKGQVSPVGRTRTAPASGQDMSELRFALFS
CSNWEAGYFNAYRDMSQRGDIDYALHVGDYIYEYKRGEYTGKTGAVRDHEPANEIVSLAD
YRQRYALHHTDPDVQAGHAACPWIVTWDDHEVANDAWSGGAENHSPEEGDFTARRNAAMQ
AYTEWLPIRATPVSQGGHIYRNLGFGNLLELNMLDLRTYRNEQASFKNSKVVDDDSRTMM
GSEQFGWLTKKLASSTARWNVIGNSVMISPVLIPPLDPQTTAAVTQLLGLPEQGMPYNFD
QWDGYAAERRKLIRFLQDKNINNTVWLTGDIHTSWAVDVPVEPATYPASGTAAVEIVCPS
LTSSNIDDILKLPEDNPLSQGAELAFTNLNKHIQYLDMDSHGYTVVQITPDFVQADWLFQ
APDGKLIAGAPLHYAQSARAAHGQGIRPTMGAINPAVHSAR
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacacctctccttccgcgcgttctgcggttccccgccgccgcgtgctccaaacc
ggcgccgtgggcgccgccgcgctgggcctcagcgccgccctccccccgtccgcctcagcc
aacgcccctgccgcacccgtcgccggggcccctgctcccgggtccgccggctcagccttc
cagcacggcgttgcctccggcgacccctaccccaccagcgtgatcctctggacgcgcatc
accagtaacgacgccgactaccccggcctcggcaaaggcacgcccacggccgtgacgtgg
gaagttgccccggatgagggcttcgggacgatcgtgagcagcggatccgccaccgccact
ccggatactgacatgacagtgaaggtggaggccgccaacctgcagccttataccccgtac
ttctaccgctttaccgtggccgatggggagaagaagggccaggtctctccggtaggccgc
acccgcaccgcaccggcctccggccaggacatgtccgagctgcgcttcgccctgtttagc
tgctccaactgggaggccggctacttcaacgcgtaccgagacatgtcccagcgcggcgac
atcgactacgcactgcacgtgggcgattacatctacgagtacaagcgcggtgaatacacc
ggcaagaccggcgccgtgcgcgaccacgagcccgccaacgagatcgtgtccctggcggac
taccgccagcgctacgccctgcaccacaccgatccggacgtacaggccggccacgccgcc
tgcccgtggatcgtcacctgggatgaccacgaggtcgccaacgatgcctggtccggcggt
gcggagaaccactcgcccgaggagggcgatttcaccgcgcgccgcaatgccgccatgcag
gcctacacggaatggctgccaatccgtgccaccccggtatcccagggcgggcacatttac
cgcaatttgggcttcggcaacctgctggagctcaacatgctggatctgcgcacctaccgc
aatgagcaggcaagctttaagaattccaaggtggtggacgacgatagccgcaccatgatg
ggttccgagcaattcggttggctcactaagaagttggcttcatccaccgctcgctggaac
gtgatcggcaattcggtgatgattagcccggtccttattccgccgctggatccgcaaacc
actgccgctgttactcagctccttggccttcccgaacaaggcatgccttacaatttcgac
caatgggacggatatgcggctgaaaggcgcaagctgatccgattcctccaagacaagaac
atcaacaacaccgtgtggttgacgggcgatattcacacctcgtgggccgtggatgttccc
gtggagcccgcgacctaccccgcttccggcacggctgctgtggaaattgtatgcccctcc
ttaacgtcttctaatattgacgatattttgaaactcccggaggataatccgctgagccag
ggcgctgaattggcattcacgaatctgaataagcacattcagtacctggatatggattcc
cacggttacacggttgtgcagatcactccggacttcgtgcaggcagactggctgttccag
gcgccggacggcaagctcatcgccggagcgccactgcactacgcacagtccgcgcgtgcc
gcgcacggccagggcatccgccccaccatgggcgcgattaaccccgctgtgcactctgca
cgctaa

DBGET integrated database retrieval system